KEGG   Bacillus subtilis subsp. subtilis 168: BSU08940
Entry
BSU08940          CDS       T00010                                 

Symbol
yhbD
Name
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: DUF4004 HTH_26
Other DBs
NCBI-GeneID: 936214
NCBI-ProteinID: NP_388775
Pasteur: BG12237
BSORF: BG12237
UniProt: P97032
Position
970667..971383
AA seq 238 aa
MLCFVFGLNNVTVLCYNVPIKGAGLMEEQLISKKELLERTSISYGQLYRWKRKNLIPEEW
FIRKSTFTGQETFFPREEILKRISMIQKMKENLSLDEMREMLSPKMKDVSMTADELLHKG
LVSRPALEAYSEDGGSPVFSSSDLLSLFVLEGLLQSGNVSLAEAKMAAEVLKKHDTEEIE
KQTELIVLRKLGVTTCFIAAAADSILFESSVKVVERVDLLKASEELKTTFMQEGHQWM
NT seq 717 nt   +upstreamnt  +downstreamnt
atgctttgtttcgtttttgggcttaacaacgtaacagtgttatgttacaatgtacccatc
aaaggagctggacttatggaagaacaattaatctctaaaaaagaattacttgaaagaaca
tcgatttcatacggtcagctgtatcgatggaagcggaaaaacttaatacctgaggaatgg
tttattcgtaaatccacatttacagggcaagagacgttttttccgagagaggagatttta
aaacgtatatcaatgattcaaaagatgaaagaaaatttgtctttggatgaaatgagggaa
atgctgtcgccgaaaatgaaggatgtcagcatgaccgctgatgaattgcttcataaaggt
ttggtttcaaggcctgctcttgaagcctattcagaagacggaggaagtccggttttttca
tccagcgatttgctttcgctgtttgtgcttgagggcctgctgcagtctggaaatgtcagc
cttgcagaagcaaaaatggctgcagaggtattaaagaagcatgatactgaagagattgaa
aaacagacggagctgattgtgctccgcaagctcggtgtcacaacttgttttatagcggct
gcggcggacagcattttgtttgaatcatccgtaaaggttgtggaacgggtagatttatta
aaagcttcagaggaattaaaaacaacatttatgcaggagggccatcaatggatgtag

DBGET integrated database retrieval system