KEGG   Bacillus subtilis subsp. subtilis 168: BSU08950
Entry
BSU08950          CDS       T00010                                 

Symbol
yhbE
Name
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: Bactofilin DUF2807
Other DBs
NCBI-GeneID: 939252
NCBI-ProteinID: NP_388776
Pasteur: BG10802
BSORF: BG10802
UniProt: P39132 A0A6M3Z8S9
Position
971374..972087
AA seq 237 aa
MDVVEKLVINGSGSSKGGTFQSVEINGSGTVAGDVECDTFSFNGNGKADGSVKAKAVTIS
GSGKIHGDVEAESIRMNGTGFIQGEVSAKQLKIAGSSTFGGTVKADGIDISGKAVMEADC
ETETFQSEGKCKISGLLNADQVIIKLSAGESYAREIGCRHLQVTCRKGMLTLLRLMPQPV
LTAELIEGDVIELTNTKAKTVRGNKVIIGPDCQIETVEYSGDYTCDPSASVETSTKL
NT seq 714 nt   +upstreamnt  +downstreamnt
atggatgtagtggaaaagctggtgataaatggatcaggaagttctaagggaggaacattt
caatcagttgagattaatggcagcgggacagtggccggggacgtggagtgtgacactttt
tcttttaatggaaacggaaaagcggacggcagcgtcaaagcgaaagcggtaactatcagc
ggttcaggaaagatacatggagacgttgaagcagaatctatccggatgaatggcactggt
tttattcaaggagaggtatctgcaaaacaattgaaaatcgctggatcatcaacatttggc
ggcactgtcaaggctgatggaattgacattagcggaaaagctgtcatggaagcagattgt
gaaacagaaacctttcaatcagaagggaaatgcaaaatcagcgggcttttaaatgcagac
caggtgatcattaagctttctgcaggggaaagctatgcgcgggagatcggctgccgccat
cttcaagtgacctgcagaaaaggaatgctgacattgctcagattgatgccgcagcctgtt
ctaacagcagagctgatcgaaggtgacgtgattgaattgacaaatacaaaggcgaaaacc
gtgcgcggtaataaagtgatcatcggcccggattgccagattgaaaccgtcgaatacagc
ggggactatacctgtgatccaagcgcgtcggttgaaacatccacaaagttgtaa

DBGET integrated database retrieval system