KEGG   Bacillus subtilis subsp. subtilis 168: BSU08960
Entry
BSU08960          CDS       T00010                                 

Symbol
yhbF
Name
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: Bactofilin
Other DBs
NCBI-GeneID: 936219
NCBI-ProteinID: NP_388777
Pasteur: BG10803
BSORF: BG10803
UniProt: P39133 A0A6M4JGA0
Position
972099..972806
AA seq 235 aa
METTKLGNLKLYGAGHAAGGAYHNVSIKGEGIVGEGLSAVGCRIYGTGLFLGKAETERLR
VLGESECKGDLTAGKINIYGTMKVSGSLQFDRFNLKGQTEIGGNMTGESCDVKGKLSVIG
DCETEMFHVTGCVDVSGLLNSGEIKLGLSHDISHVQEIGGTTITVKRRASFFSRKKGKLI
ADVIEGDRVYLENTEAAVVRGKEVIIGPGCSIGTIEYEYKCECDPHSQIKEKTKL
NT seq 708 nt   +upstreamnt  +downstreamnt
atggagacaacaaaactgggaaatttaaaattatatggcgctgggcatgccgcaggaggc
gcgtatcacaatgtcagcatcaaaggagaaggtatagttggagaagggctgtctgctgta
ggctgccgcatatacggaacgggcctttttctcggaaaagcagagactgagcggctgcgt
gtgctcggagaaagtgaatgtaaaggcgatctgacagccggcaaaatcaatatatatggg
acaatgaaagtcagcggctcacttcaatttgatcgattcaatctgaaaggccagactgaa
attggcgggaatatgactggagaatcctgcgatgtgaaagggaagcttagcgtaataggt
gattgtgaaacagaaatgttccatgtcacaggctgtgttgatgtatcggggttattaaat
tcgggtgagatcaagctgggattgagccatgatataagccatgtgcaggaaatcggcgga
acaacaattacagtgaaaagacgcgcgagtttttttagccggaagaaagggaagctgatc
gccgatgtcatagaaggagatcgggtttatttggagaataccgaagcggcagttgtcagg
ggaaaagaagtgatcatcgggccgggatgcagcatcggaacgattgagtacgaatacaaa
tgtgaatgcgatccgcattcacagattaaagaaaaaacaaaactgtaa

DBGET integrated database retrieval system