KEGG   Bacillus subtilis subsp. subtilis 168: BSU08970
Entry
BSU08970          CDS       T00010                                 

Symbol
prkA
Name
(RefSeq) serine protein kinase PrkA
  KO
K07180  serine protein kinase
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99995 Signaling proteins
    BSU08970 (prkA)
SSDB
Motif
Pfam: AAA_PrkA PrkA AAA_16 Rad17 VHL_C Sigma54_activat AAA_22 SWIB
Other DBs
NCBI-GeneID: 939250
NCBI-ProteinID: NP_388778
Pasteur: BG10804
BSORF: BG10804
UniProt: P39134 A0A6M3Z962
Position
973156..975051
AA seq 631 aa
MDILKKIEKYREEEQRLKWEGTFADYLEIIKENPMVAQSAHSRVFNMIKDSGIEEIDGRK
KYSFFDRELFGLEESLERLVEEYFHPAAKRLDVRKRILLLMGPVSGGKSTLVTMLKKGLE
AYTLTDNGAVYAIKGCPMHEDPLHLIPHHLRDDFYREYGIRIEGSLSPLNVMRLEEEYGG
RIEDVKVERIFFSEDKRTGIGTFSPSDPKSQDIADLTGSIDFSTIAEYGSESDPRAYRFD
GELNKANRGMMEFQEMLKCDEKFLWHLLSLTQEGNFKAGRFALISADELIVAHTNETEYR
SFISNKKNEALHSRIIVMPVPYNLKVSEEERIYEKMIAESDVADVHIAPHTLKVAAMFSI
LTRLKEPKRSDIDLVKKMRLYDGESVEGYNSVDVEDMKKEYNDEGMSGIDPRYVINRISS
TIIRKNMESINSLDVLRSLKEGLDQHPSISSEDRERYLNFISAARKEYDDIAKKEVQKAF
VYSYEESAKTLMDNYLDNVEAYCNKNKLRDPLTGEEMNPDEKLMRSIEEQIGISENAKKA
FREEILIRISAYARKGKRFDYNSHERLREAIQKKLFADLKDVVKITTSTKTPDEQQLKKV
NEVVARLIDEHGYNSTSANELLKYVGSLLNR
NT seq 1896 nt   +upstreamnt  +downstreamnt
atggatatattaaagaaaattgaaaagtacagagaggaagagcagcggctgaaatgggaa
ggaactttcgccgattatttggagattattaaagaaaatccgatggtcgcgcaatctgct
cattctcgagtttttaatatgataaaagacagcgggatagaggagattgacggacgcaag
aagtacagtttttttgaccgcgagctgttcgggcttgaagaatctctggagcgtcttgtg
gaagagtattttcatccggctgccaaacgtctagatgtcagaaagcggattctattgctg
atggggcctgtgagcggcggtaaatccacgctggtcacaatgcttaaaaaaggtctcgaa
gcgtacacgctgacagataatggcgctgtatatgcgattaaaggctgcccgatgcacgag
gaccctctacatttaatcccccatcatttacgcgatgacttttacagagaatacggcatt
agaatagaaggaagtctttctcctttaaatgtcatgaggctggaggaagagtacggagga
agaattgaggatgtgaaggtggagcgcatcttcttttcagaagataagcgtacgggaatt
ggaacattcagtccctctgatccgaaatctcaggatattgccgatttgacggggagtatt
gatttctcaacaatcgccgagtacggttcagaatcagatccgcgcgcttatcgatttgac
ggagagctgaataaagcgaaccgcgggatgatggagtttcaggagatgctgaaatgtgat
gagaaatttctctggcatttgctttccttgacacaggaagggaattttaaagctgggcgg
tttgcgttaatttctgctgatgagctgatcgtggctcacacgaatgaaacggagtatcgc
tcatttatttctaataagaagaatgaagccctgcactcaagaatcatcgtgatgccggtt
ccttataatttaaaagtgtctgaggaagagagaatttatgaaaaaatgattgcagaaagc
gatgtggcggatgttcatattgccccgcatacgttgaaggtcgccgcgatgttctcaatc
cttacccggttaaaagagccgaagcggtcggatattgatctggtcaagaaaatgagactg
tatgatggggaaagtgtggaaggatataactctgtcgacgttgaggatatgaaaaaagaa
tataatgatgaaggcatgagcggaattgatccgcggtacgtgatcaaccggatttcttca
acgattatcagaaaaaatatggaatcgattaattctctcgatgtccttcgctccttaaaa
gaaggtcttgatcagcacccatcaatttcaagcgaggacagggagcggtatttgaatttt
atctctgccgcccgcaaggaatatgacgatattgcgaaaaaggaagttcaaaaagcgttt
gtttattcatatgaagaatcagcaaaaacacttatggacaattacctcgataacgtagag
gcctattgcaataaaaacaagcttcgtgatcctttgacaggagaggaaatgaaccctgac
gaaaagctgatgagatccatcgaagagcagatcggcatttcggaaaacgccaaaaaagcg
ttccgcgaagaaattttaatccgcatctcggcctatgcgagaaaaggcaagcggtttgat
tacaattcccatgaaagactgcgtgaagctattcagaaaaagctgtttgctgatctgaag
gatgtcgttaaaattacgacctcaacaaaaacgccggatgagcagcagctgaaaaaggta
aatgaagtcgtggcccgtttaattgatgagcacggctacaactcgacgagcgccaatgag
ctgctgaaatatgtcggcagcctgctgaaccgataa

DBGET integrated database retrieval system