KEGG   Bacillus subtilis subsp. subtilis 168: BSU08980
Entry
BSU08980          CDS       T00010                                 

Symbol
yhbH
Name
(RefSeq) stress response UPF0229 protein YhbH
  KO
K09786  uncharacterized protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99997 Function unknown
    BSU08980 (yhbH)
SSDB
Motif
Pfam: DUF444 DUF4835
Other DBs
NCBI-GeneID: 936217
NCBI-ProteinID: NP_388779
Pasteur: BG11238
BSORF: BG11238
UniProt: P45742 A0A6M3ZE20
Position
975231..976409
AA seq 392 aa
MSQNDSGHFLISEENWSLHRKGFDDQQRHQKKVQEAIKNNLPDLVTEESIIMSNGKDVVK
IPIRSLDEYKIRYNYDKNKHVGQGDGESQVGDVVARDGSDKKQGPGKGQGAGDQAGEDYY
EAEVSLMDLEEALFKELELPNLQQKERDNIIHTDIEFNDIRKTGLTGNIDKKRTMMSAFK
RNAMSGKPSFYPIYPEDLKYKTWNDITKPESKAVVLAMMDTSGSMGVWEKYMARSFFFWM
TRFLRTKYETVEIEFIAHHTEARVVSEEDFFSKGESGGTICSSVYRKSLELIDEKYNPAR
YNIYPFHFSDGDNLTSDNARCVKLVNDIMKKANLFCYGEVNQYNRHSTLMSAYKNVKDEK
FKYYILKQKSDVFQALKNFFRNEESGVSHQFS
NT seq 1179 nt   +upstreamnt  +downstreamnt
atgtcccaaaatgacagcggccattttttgatttctgaggaaaactggtccctccatcgc
aaaggcttcgatgaccagcagcgccaccagaaaaaagtgcaggaagcgatcaaaaacaat
cttccggacctcgtaactgaggaaagcattattatgtctaatggaaaagatgtagtgaag
atcccaatccgttcacttgatgagtataaaatccgttataactatgataaaaataaacat
gtagggcaaggagacggcgagagccaggttggagatgttgtggcccgggatggatcagac
aaaaaacaagggcctggaaaagggcagggtgccggtgatcaggcaggcgaggattattat
gaagcggaagtttcattaatggatttagaagaagcgctttttaaagaattagagcttccg
aatctccagcaaaaagagcgggacaatatcattcatacagatatcgagtttaatgatatc
cgtaaaacagggttaaccggtaatattgataagaaaagaacgatgatgtcagcctttaaa
cgaaacgcaatgtcaggaaaaccgtcgttctacccaatttatccggaggacctgaaatat
aagacgtggaatgacatcacaaagcccgaatcaaaagccgtcgttttagccatgatggat
acaagcggcagtatgggggtttgggaaaaatacatggccagaagcttctttttctggatg
acccgttttttgcggacaaaatacgagactgtggaaattgaatttattgcccatcataca
gaagcaagagtggtctcggaggaggattttttctcaaagggagaaagcggcggaacaatt
tgttcttccgtatatcggaagtcgcttgagcttattgatgaaaagtacaatcccgcccgc
tataacatttacccgtttcatttttctgacggtgacaacctgacatctgataacgcgcgc
tgtgtgaagctggtcaatgatattatgaagaaggccaatctgttttgctacggcgaggtc
aatcagtacaacaggcattcaacgttaatgtctgcatataaaaatgtaaaagatgagaaa
tttaagtactatattttaaaacagaaatctgatgtttttcaggctctaaagaactttttc
agaaatgaagagtctggtgtaagccatcaattttcgtaa

DBGET integrated database retrieval system