KEGG   Bacillus subtilis subsp. subtilis 168: BSU08990Help
Entry
BSU08990          CDS       T00010                                 

Gene name
yhbI
Definition
(RefSeq) MarR family transcriptional regulator
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MarR MarR_2 HTH_27
Motif
Other DBs
NCBI-GeneID: 939247
NCBI-ProteinID: NP_388780
Pasteur: BG13003
BSORF: BG13003
UniProt: O31592
Position
976569..977033
Genome map
AA seq 154 aa AA seqDB search
MTESERALLTFEQLFDTSRAIYKKQKKILEIVLEPFDITVLQYLLMFKIHQSGSTPLSKL
AMSLDLKPASVTRMTDILYKRQLMNRYDSPDDRRIVMIQLTEEGEELIEKAAVQYAKMGA
GLYQKLDTSQLQYLRKLAGSLTKLAEGCSEKSGN
NT seq 465 nt NT seq  +upstreamnt  +downstreamnt
ttgactgaatcagaacgtgctttgctcacttttgaacagctcttcgatacgtctcgggcg
atatataaaaaacagaagaagatattggagattgtgcttgagccttttgatattacagtc
cttcaatatttgctgatgtttaaaattcatcaaagcggaagcaccccgctaagcaagctg
gcaatgtcgcttgatcttaagcctgcttctgtgacgcggatgacagatattctgtataag
cgccaattgatgaatcgatatgacagtccggatgaccgccgtatcgtcatgattcagtta
accgaagagggggaagaactgatagaaaaagccgctgtgcaatatgcaaaaatgggtgct
ggcttgtaccaaaagcttgatacctcccagctgcagtatttgcgcaaactagccggaagt
ttaacgaagcttgctgaaggctgttcagaaaaaagcggtaattaa

DBGET integrated database retrieval system