KEGG   Bacillus subtilis subsp. subtilis 168: BSU09000
Entry
BSU09000          CDS       T00010                                 

Symbol
yhbJ
Name
(RefSeq) efflux system component YhbJ
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: HlyD_3 HlyD_D23 Biotin_lipoyl_2 Biotin_lipoyl CusB_dom_1 HlyD_2 QRPTase_N Peptidase_M23 LysM
Other DBs
NCBI-GeneID: 936216
NCBI-ProteinID: NP_388781
Pasteur: BG13004
BSORF: BG13004
UniProt: O31593 A0A6M4JHP9
Position
977069..977734
AA seq 221 aa
MIEDETKGENKMNRGRLILTNIIGLIVVLAIIAGGAYYYYQSTNYVKTDEAKVAGDMAAI
TAPAAGKVSDWDLDEGKTVKKGDTVAKIKGEQTVDVKSIMDGTIVKNEVKNGQTVQAGTT
IAQTIDMDNLYITANIKETDIADIEVGNSVDVVVDGDPDTTFDGTVEEIGYATNSTFDML
PSTNSSGNYTKVTQKVPVKISIKNPSDKVLPGMNASVKISE
NT seq 666 nt   +upstreamnt  +downstreamnt
atgatagaggatgaaacgaaaggagaaaacaaaatgaacagaggacgtttaattctgacc
aacattatcggtttgattgttgttcttgcaattatagctggaggtgcttactactattat
caaagcacaaactacgtaaaaacagatgaagcaaaagtagcgggcgatatggctgctatt
actgctccagcagcaggtaaagtatctgactgggatctggacgaaggaaaaacagtgaaa
aaaggcgacacagttgcaaaaatcaaaggtgaacaaactgttgacgtaaaatccattatg
gatggcacaattgtgaaaaacgaagtgaaaaacggacaaaccgtacaagctggtacaaca
attgcacaaacgattgacatggacaacctatacatcacagcaaatattaaagaaacagat
attgcggatattgaagtaggaaatagtgtagacgtagtagttgacggagaccctgatact
acatttgacggtactgtagaagaaattggttatgcgactaactcaacttttgatatgctt
ccttctacaaattcaagcggaaactacacaaaagtaacacaaaaagttcctgtgaaaatt
tcaatcaaaaacccatctgataaggtgcttcctggaatgaatgcatctgttaaaatttct
gagtaa

DBGET integrated database retrieval system