KEGG   Bacillus subtilis subsp. subtilis 168: BSU09010
Entry
BSU09010          CDS       T00010                                 

Symbol
yhcA
Name
(RefSeq) MFS transporter
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: MFS_1 Sugar_tr
Other DBs
NCBI-GeneID: 936235
NCBI-ProteinID: NP_388782
Pasteur: BG11579
BSORF: BG11579
UniProt: P54585 A0A6M3Z8V5
Position
977775..979373
AA seq 532 aa
MATGKEKNAKNPMSLLIVLMAGLFLAILNQTLLNVAMPHLMTEFGVSATTIQWLTTGYML
VNGVLIPLSAFLITRFGQRSLFLVAMFCFTLGTLVCGIAPNFSTMLIGRLIQAVGGGILQ
PLVMTTILLIFPPESRGKGMGIFGLAMMFAPAVGPTLSGWIIEHYTWRIMFYGLVPIGAI
VIIVAFFIFKNMVEPQKIKLDTLGAILSIVGFASLLYGVSEAGSDGWTDPIVLSTVIIGA
IAIVAFVVQQLRHDDPMLDFRVFKYDIFSLSSVINIIITVALYTGMFLLPIYLQNLVGFT
ALQSGLLLLPGAIVMLIMSPISGILFDKFGPRPLAIIGLLVTVVTTYQYTQLTIDTPYTH
IMLIYSIRAFGMSLLMMPVMTAGMNQLPARLNSHGTAMSNTLRQISGSIGTSLITTIYTN
RTTFHYSQIADKTSTADPNFLHAFQNAVSNLMVNMNVSYDTAKTYVYSHIYKHASLDSNV
MGINDAFMWATLFCVAGLILSIFLRDVRKDKLRKKKKEELSLLPAPKEAKES
NT seq 1599 nt   +upstreamnt  +downstreamnt
atggctacaggcaaagaaaaaaatgcaaaaaaccctatgtcattgctgattgtgctaatg
gcgggtttatttttggcaattctaaaccaaacactgcttaatgttgcaatgccgcactta
atgactgaatttggcgtaagtgcaacgacgattcagtggctgacaacaggttacatgctt
gttaacggtgtattgattccgttatctgctttcctgattacacgatttggccagcggagt
ctctttctcgtcgcgatgttttgttttacgctcggtacgttagtctgcggtatcgcacct
aacttctctacaatgctgatcggccgtttgattcaggccgtgggcggaggtatcttgcag
ccgctcgttatgacaaccattctgttaattttcccgcctgaaagcagggggaaaggaatg
gggattttcgggctagcgatgatgtttgctccagcggtcggcccgactctttccgggtgg
attattgagcattatacatggcgcattatgttttacggacttgtgccgatcggcgcaatt
gttatcattgtggctttcttcatctttaaaaatatggtggagccgcaaaaaatcaaactc
gatactcttggcgcaatcctctcgattgtcggattcgcctccttattatacggagtcagt
gaagccggatctgacggctggaccgacccgattgtattgtctacagttattatcggagcc
attgcaattgttgcttttgttgttcagcaattgcgtcatgatgatccgatgcttgatttc
agagtgtttaaatatgacattttctcactctcgagtgtcattaatatcattattacagtg
gcactttacactggtatgttccttttaccgatttatctgcaaaacctggtcggctttacg
gcgcttcaatccggtctgcttctgcttccgggtgcgatcgttatgctgattatgtcaccg
atctcaggtattttgttcgataaattcggaccgagaccgcttgcgattatcgggcttctc
gtgacagtggtaacaacgtatcaatacacgcaattgacaattgatacaccatatacacac
atcatgctgatctattcaattcgtgcatttggtatgtctctcttaatgatgccagtcatg
acagccgggatgaaccagcttcctgcccgtctgaacagccacggaacggcgatgagtaac
acgcttcgccaaatcagcggatcaatcggaacaagtttaattacgacgatttatacaaac
cggacgacattccattattcacaaattgcagataaaacaagcacggcggacccgaacttc
ctccatgcgttccaaaatgcagtttcgaatttaatggtgaatatgaatgtgtcttatgat
acggcgaaaacatatgtgtactcacatatttataaacacgcatcactcgattccaatgtc
atggggataaatgatgcctttatgtgggcaaccttattctgtgtagcaggtttgatttta
agtatcttcctgcgtgacgtcagaaaagataaattgcgtaagaagaaaaaagaggagctt
tcattacttcctgctccaaaagaagctaaggaatcttaa

DBGET integrated database retrieval system