KEGG   Bacillus subtilis subsp. subtilis 168: BSU09020Help
Entry
BSU09020          CDS       T00010                                 

Gene name
yhcB
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FMN_red Flavodoxin_2 Flavodoxin_5 Flavodoxin_1 Flavodoxin_3 DUF2480
Motif
Other DBs
NCBI-GeneID: 939734
NCBI-ProteinID: NP_388783
Pasteur: BG11580
BSORF: BG11580
UniProt: P54586
Position
979396..979926
Genome map
AA seq 176 aa AA seqDB search
MKIYVVYDSEGEHTKVLAEAIAEGARENDAAEVFIDHVDQADIRKLKDMDAIIWGCPGHF
GTISSGLKTWIDRLGYLWAEGELINKVGAVFCTTATTHGGLEMTMHNLITPMFHQGMIVV
GLPGNVPENALYGSYYGAGVTCPVDSDELMSEEGIQLGRALGRRVSQVTGNLTAGQ
NT seq 531 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatttatgtagtgtatgatagtgaaggcgaacatactaaagtgcttgcagaagcg
attgctgaaggcgcgagagaaaacgacgcggctgaagtgttcatcgaccatgtagatcag
gctgatatccgcaagcttaaagatatggatgcgattatttggggatgcccagggcatttc
ggaacaatcagctccggtcttaaaacttggatcgacagacttggctacttgtgggctgaa
ggcgagctgatcaacaaagtcggtgctgtcttctgcacaacggcaacaacacacggcggc
ttggaaatgacaatgcacaatttaatcacgccgatgttccaccaaggcatgattgttgtc
ggactgcctggcaacgtgcctgaaaacgcactttatggctcttattacggagcaggtgtc
acttgtccggtagacagtgatgagttaatgtctgaggaaggtattcagcttggacgcgcg
ttgggaagacgtgtcagccaagtcacaggaaacctaacagcaggacagtaa

DBGET integrated database retrieval system