KEGG   Bacillus subtilis subsp. subtilis 168: BSU09030
Entry
BSU09030          CDS       T00010                                 

Symbol
yhcC
Name
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: Nmad2 O-antigen_lig DUF4192
Other DBs
NCBI-GeneID: 936220
NCBI-ProteinID: NP_388784
Pasteur: BG11581
BSORF: BG11581
UniProt: P54587 A0A6M3Z8U6
Position
979939..980313
AA seq 124 aa
MAIIIAIIAAVIVIAALITFNVRNASPGPEKQEATDRIAPPEEEKNEAHYPAEARAAEHT
PSVVKNDSPKEKRDTMGDDIYRQALQKFKHSDEVHAEEEVTEESDKMQDRSYRDALLSMK
NKKK
NT seq 375 nt   +upstreamnt  +downstreamnt
atggccattattatagcaataattgctgctgtcattgtcattgcggcccttattacattt
aacgtccgcaacgcctcacctggacctgagaagcaagaagcaaccgatagaatcgcacct
ccagaagaggaaaaaaacgaagcgcattaccctgctgaagcaagggctgccgagcatacg
ccatccgttgtcaaaaacgattctccaaaagagaagcgtgacacaatgggtgatgatatt
tacaggcaggcgctgcaaaagtttaagcattctgatgaagttcatgcagaagaagaggtc
actgaggaaagtgacaaaatgcaggaccgcagctatcgtgatgcgctgctctctatgaaa
aataagaaaaagtaa

DBGET integrated database retrieval system