KEGG   Bacillus subtilis subsp. subtilis 168: BSU09030Help
Entry
BSU09030          CDS       T00010                                 

Gene name
yhcC
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF4192 O-antigen_lig
Motif
Other DBs
NCBI-GeneID: 936220
NCBI-ProteinID: NP_388784
Pasteur: BG11581
BSORF: BG11581
UniProt: P54587
Position
979939..980313
Genome map
AA seq 124 aa AA seqDB search
MAIIIAIIAAVIVIAALITFNVRNASPGPEKQEATDRIAPPEEEKNEAHYPAEARAAEHT
PSVVKNDSPKEKRDTMGDDIYRQALQKFKHSDEVHAEEEVTEESDKMQDRSYRDALLSMK
NKKK
NT seq 375 nt NT seq  +upstreamnt  +downstreamnt
atggccattattatagcaataattgctgctgtcattgtcattgcggcccttattacattt
aacgtccgcaacgcctcacctggacctgagaagcaagaagcaaccgatagaatcgcacct
ccagaagaggaaaaaaacgaagcgcattaccctgctgaagcaagggctgccgagcatacg
ccatccgttgtcaaaaacgattctccaaaagagaagcgtgacacaatgggtgatgatatt
tacaggcaggcgctgcaaaagtttaagcattctgatgaagttcatgcagaagaagaggtc
actgaggaaagtgacaaaatgcaggaccgcagctatcgtgatgcgctgctctctatgaaa
aataagaaaaagtaa

DBGET integrated database retrieval system