KEGG   Bacillus subtilis subsp. subtilis 168: BSU09040
Entry
BSU09040          CDS       T00010                                 

Gene name
yhcD
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Other DBs
NCBI-GeneID: 939260
NCBI-ProteinID: NP_388785
Pasteur: BG11582
BSORF: BG11582
UniProt: P54588
Position
980313..980468
AA seq 51 aa
MKKANPFTHAGLPFLLFPSIMFLSNKSMEYVVFHLDLVYYVTHTPRIFSGR
NT seq 156 nt   +upstreamnt  +downstreamnt
atgaaaaaggcaaatccgtttactcatgcgggtttgccttttttgctgtttccatcaatt
atgtttttatcaaataaatccatggaatatgttgtattccaccttgatctagtgtactat
gttactcatacaccgaggattttttccgggaggtaa

DBGET integrated database retrieval system