KEGG   Bacillus subtilis subsp. subtilis 168: BSU09060
Entry
BSU09060          CDS       T00010                                 

Gene name
yhcF
Definition
(RefSeq) GntR family transcriptional regulator
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: GntR Rrf2 HTH_Crp_2 DUF6074 HTH_36 LexA_DNA_bind Bet_v_1 DUF5908
Other DBs
NCBI-GeneID: 936231
NCBI-ProteinID: NP_388787
Pasteur: BG11584
BSORF: BG11584
UniProt: P54590 A0A6M4JGA9
Position
981237..981602
AA seq 121 aa
MDNQFQSSKPIYLQIADQIFYRLVRKELLPGDKLPSVREMAIQTKVNPNTIQRTYSEMER
LGIVETRRGQGTFIAEKAEIVDELKDKLTREVLEGFVKQMKELGLTKEEMLEGIKTFTEG
G
NT seq 366 nt   +upstreamnt  +downstreamnt
atggacaatcaattccaatcctcgaaaccgatttatctgcagatcgctgatcagatcttt
tataggctggtcaggaaggagctgctcccaggagacaagcttccttcagtaagagaaatg
gcgattcaaactaaagtaaatcccaatacaattcaaagaacttacagtgagatggaaagg
ctgggtattgtggagacaagaagaggtcaagggacgtttattgcggaaaaagcagaaatc
gtagacgagctgaaagacaagctgacacgagaggtgctggaaggctttgtcaagcaaatg
aaagagctggggctaacgaaagaagaaatgttagaagggattaaaacattcacagaggga
ggctaa

DBGET integrated database retrieval system