KEGG   Bacillus subtilis subsp. subtilis 168: BSU09080
Entry
BSU09080          CDS       T00010                                 

Symbol
yhcH
Name
(RefSeq) ABC transporter ATP-binding protein
  KO
K01990  ABC-2 type transport system ATP-binding protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bsu02000]
    BSU09080 (yhcH)
Transporters [BR:bsu02000]
 ABC transporters, prokaryotic type
  ABC-2 type and other transporters
   ABC-2 type transporter
    BSU09080 (yhcH)
SSDB
Motif
Pfam: ABC_tran AAA_21 DUF4162 AAA_30 AAA_23 SRP54 RsgA_GTPase TsaE AAA_11 AAA_22 MRFAP1 AAA
Other DBs
NCBI-GeneID: 936229
NCBI-ProteinID: NP_388789
Pasteur: BG11586
BSORF: BG11586
UniProt: P54592 A0A6M4JGR0
Position
982319..983236
AA seq 305 aa
MKTVLELKNVTKNIRGRTIIDDLSFTIREGEVFGFLGPNGAGKTTTIRMMVGLMKLSKGD
VLICGQSITKEYAKAIKHIGAIVENPELYKFLSGYKNLQQFARMVKGVTKEKIDEVVELV
GLTDRIHDKVKTYSLGMRQRLGLAQCLLHDPKVLILDEPTNGLDPAGIREIRDHLKKLTR
ERGMAVIVSSHLLSEMELMCDRIAILQKGKLIDIQNVKDENIDENDTYFFQVEQPSEAAT
VLNQYDLLSKTNGVEIKLAKEEVPAVIELLVMQQIRIYEVKVITKSLEDRFLEMTGETKE
EVQHA
NT seq 918 nt   +upstreamnt  +downstreamnt
atgaaaacagtgttggaattgaaaaacgtgactaaaaacatcagaggccgaacgatcatt
gatgatctcagttttacgattcgtgaaggcgaggtattcggttttttaggaccaaacgga
gcggggaaaacgacaaccatccggatgatggtggggttaatgaagctgtcgaaaggtgat
gtcctcatttgcggccaatcaattacgaaagaatatgccaaggcgattaagcatatcgga
gcgatcgttgagaatcccgagctgtataaatttttgagcggatataaaaatctccagcaa
ttcgcaaggatggtcaagggtgtcacgaaggaaaaaattgatgaagttgttgaactggtc
ggtttaacagacagaatccacgacaaggtgaaaacatattctctggggatgagacagcgt
cttggcttggcacaatgccttctgcacgatccgaaagtgctgattttggatgaaccgaca
aacggccttgatccggcggggatcagagaaatcagagatcatttaaagaagctgacccga
gaaagaggaatggctgtcatcgtttcaagccacctgctgtcagaaatggaactgatgtgt
gatcgaattgcgattctgcaaaaaggaaagctgatcgatattcaaaatgtaaaagatgaa
aacattgatgagaatgatacatatttcttccaggttgagcagccgagtgaagccgctact
gttttaaatcagtacgatttgctgagtaagacaaatggtgtagaaatcaaactggctaaa
gaggaagtccctgcggttattgaattgctggtgatgcagcaaatccgtatttatgaggtc
aaggtcataacaaaatcattagaggaccgtttcttagaaatgacaggtgaaacaaaagag
gaggttcagcatgcttaa

DBGET integrated database retrieval system