KEGG   Bacillus subtilis subsp. subtilis 168: BSU09090
Entry
BSU09090          CDS       T00010                                 

Symbol
yhcI
Name
(RefSeq) hypothetical protein
  KO
K01992  ABC-2 type transport system permease protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bsu02000]
    BSU09090 (yhcI)
Transporters [BR:bsu02000]
 ABC transporters, prokaryotic type
  ABC-2 type and other transporters
   ABC-2 type transporter
    BSU09090 (yhcI)
SSDB
Motif
Pfam: ABC2_membrane_2 ABC2_membrane_4 ABC2_membrane_3 DUF29 UPF0093 UL42 DUF4869
Other DBs
NCBI-GeneID: 939251
NCBI-ProteinID: NP_388790
Pasteur: BG11587
BSORF: BG11587
UniProt: P54593 A0A6M3ZE32
Position
983229..984170
AA seq 313 aa
MLNLIYNEWLKIFSRAGTWVMIGILGLTMVGFAFLANHFSAGESNSHWKQELQAQNAELK
KEIKEDPSLKDGYKETITLNDYRIEHNIPSDTGYTVWSYVTDSANFTILTGLFTIIIAAG
IVANEFNWGTIKLLMIRPLSRFQILMSKYITVLLFGLLLLLILFIGSTLLGLIFFGTGGE
TAANIHLIYKDGHVIEQNMMGHLATTYLSESVSALMVATMAFMLSAVFRNSSLAVGFSIF
LLVAGTTATAFIAAKFDWAKYILFANVDLTQYVDGTPLIKGMTMTFSLVMLAIYFIIFLL
LAFGIFMKRDIAN
NT seq 942 nt   +upstreamnt  +downstreamnt
atgcttaatttgatttataatgagtggctcaaaattttcagccgtgccggaacatgggtg
atgatcggaattctggggctgacaatggttggatttgcatttttggcgaatcatttttct
gccggtgaatcaaattcccattggaaacaagagcttcaagcacaaaacgccgaattaaag
aaagaaatcaaagaagatccttcactgaaagatgggtataaagaaacaatcacactcaat
gactatcgcatcgagcataatatccctagtgacacgggctatacggtatggtcttatgta
acggattcagcaaactttaccatccttaccggtctgtttactattatcatcgcggccgga
attgtcgcgaacgaatttaattggggaacgattaagctattaatgattcggccgctcagt
cgttttcaaattttgatgtccaaatatattacagttctcctgtttgggctcctgttgctg
ttgattttatttatcggttctactttattagggttgatcttcttcggaacgggtggtgaa
accgccgcgaatattcatttaatctataaggatggccatgtcattgagcaaaacatgatg
gggcatttggctacaacgtatctttctgaatccgtctcggctttaatggtggcgacgatg
gcgtttatgctgtctgcggtattcagaaacagctctcttgcggttggtttttccatcttc
ttgttggttgccggtacgactgcaactgcatttattgcagcgaaatttgactgggcaaag
tatatattgtttgctaatgtcgacttgactcagtatgtggatggcacaccgttaataaaa
gggatgactatgacgttttctctcgtcatgctggcgatctactttatcatcttcctgttg
cttgctttcggaatcttcatgaagcgggatattgcaaactaa

DBGET integrated database retrieval system