KEGG   Bacillus subtilis subsp. subtilis 168: BSU09100
Entry
BSU09100          CDS       T00010                                 

Symbol
cspB
Name
(RefSeq) cold shock protein CspB
  KO
K03704  cold shock protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09190 Not Included in Pathway or Brite
  09192 Unclassified: genetic information processing
   99973 Transcription
    BSU09100 (cspB)
SSDB
Motif
Pfam: CSD OB_RNB
Other DBs
NCBI-GeneID: 936224
NCBI-ProteinID: NP_388791
Pasteur: BG10824
BSORF: BG10824
UniProt: P32081 A0A6M4JHQ8
Structure
Position
complement(984262..984465)
AA seq 67 aa
MLEGKVKWFNSEKGFGFIEVEGQDDVFVHFSAIQGEGFKTLEEGQAVSFEIVEGNRGPQA
ANVTKEA
NT seq 204 nt   +upstreamnt  +downstreamnt
atgttagaaggtaaagtaaaatggttcaactctgaaaaaggtttcggattcatcgaagta
gaaggtcaagacgatgtattcgttcatttctctgctattcaaggcgaaggcttcaaaact
ttagaagaaggccaagctgtttcttttgaaatcgttgaaggaaaccgcggaccacaagct
gctaacgttactaaagaagcgtaa

DBGET integrated database retrieval system