KEGG   Bacillus subtilis subsp. subtilis 168: BSU09100Help
Entry
BSU09100          CDS       T00010                                 

Gene name
cspB
Definition
(RefSeq) cold shock protein CspB
  KO
K03704  cold shock protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09190 Not Included in Pathway or Brite
  09192 Unclassified: genetic information processing
   99973 Transcription
    BSU09100 (cspB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CSD OB_RNB
Motif
Other DBs
NCBI-GeneID: 936224
NCBI-ProteinID: NP_388791
Pasteur: BG10824
BSORF: BG10824
UniProt: P32081
Structure
PDB: 

Position
complement(984262..984465)
Genome map
AA seq 67 aa AA seqDB search
MLEGKVKWFNSEKGFGFIEVEGQDDVFVHFSAIQGEGFKTLEEGQAVSFEIVEGNRGPQA
ANVTKEA
NT seq 204 nt NT seq  +upstreamnt  +downstreamnt
atgttagaaggtaaagtaaaatggttcaactctgaaaaaggtttcggattcatcgaagta
gaaggtcaagacgatgtattcgttcatttctctgctattcaaggcgaaggcttcaaaact
ttagaagaaggccaagctgtttcttttgaaatcgttgaaggaaaccgcggaccacaagct
gctaacgttactaaagaagcgtaa

DBGET integrated database retrieval system