KEGG   Bacillus subtilis subsp. subtilis 168: BSU09110Help
Entry
BSU09110          CDS       T00010                                 

Gene name
yhcJ
Definition
(RefSeq) lipoprotein
  KO
K02073  D-methionine transport system substrate-binding protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    BSU09110 (yhcJ)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bsu02000]
    BSU09110 (yhcJ)
Transporters [BR:bsu02000]
 ABC Transporters, Prokaryotic Type
  Phosphate and amino acid transporters
   D-Methionine transporter
    BSU09110 (yhcJ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Lipoprotein_9 MF_alpha_N
Motif
Other DBs
NCBI-GeneID: 939261
NCBI-ProteinID: NP_388792
Pasteur: BG11588
BSORF: BG11588
UniProt: P54594
Position
984901..985731
Genome map
AA seq 276 aa AA seqDB search
MKKWLICSFVLVLLVSFTACSPSAEHESIKIGIAESDGAIWNYIAQKAEEAGLDIQLIPF
SDYAESDIALANKEIDANAFQTISYFQSFTEKYKLNLAPLGTTYITPMGIYSKRYERIRD
ISRGAVVSVPDKAFDFGRALTVLQEAGLLTLKNGFNGTGSVDMIKDNPRHLKLKAVRQQD
AVSGADVFVMKPSEAKKAGLNPKKHTLKSGGLMSEEEMNLIVVRAEDQDREALQTILELY
QADDTAAFIEKEYQGDLVPAFLPLKRLSDWKNEFEH
NT seq 831 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaagtggcttatatgcagtttcgtccttgttcttctcgtttcatttactgcatgt
tcaccgtctgcagaacatgaatcgataaaaatcgggattgctgagtctgacggggcaata
tggaactatattgctcaaaaggctgaagaggcagggctggatattcagctgatccctttt
tctgattatgcggagtctgatatcgcacttgctaacaaagaaattgatgccaacgccttt
caaaccatttcatattttcagtcgttcactgaaaaatacaaacttaatttggcaccgctc
gggacgacatacataacgcccatgggcatttattcaaaacgatatgaacgaatccgagat
atatcgcggggagctgtcgtttctgttccggataaagcgttcgattttggcagggcgctt
acggtgctccaggaagcgggtttgctaacgctgaaaaacggatttaacggaacaggttca
gttgatatgattaaagataatccgagacacctgaaattaaaagctgtccggcaacaggat
gcagtgagcggtgccgacgtgtttgtcatgaaaccatcagaagcaaaaaaagcgggcttg
aacccgaaaaagcatacgctaaagagcggcggactcatgtctgaggaagagatgaatttg
attgttgtcagagcggaggatcaagatcgggaagcgctgcaaaccattcttgagctttat
caagctgatgatacagcggcatttatagaaaaagaatatcagggagatcttgtcccggct
tttctgcctttgaaacgtctttcagattggaagaatgaattcgaacattga

DBGET integrated database retrieval system