KEGG   Bacillus subtilis subsp. subtilis 168: BSU09120
Entry
BSU09120          CDS       T00010                                 

Symbol
dgcK
Name
(RefSeq) diguanylate cyclase
  KO
K18967  diguanylate cyclase [EC:2.7.7.65]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    BSU09120 (dgcK)
Enzymes [BR:bsu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.65  diguanylate cyclase
     BSU09120 (dgcK)
SSDB
Motif
Pfam: GGDEF 5TM-5TMR_LYT
Other DBs
NCBI-GeneID: 936246
NCBI-ProteinID: NP_388793
Pasteur: BG11589
BSORF: BG11589
UniProt: P54595 A0A6M4JLE6
Position
complement(985734..986813)
AA seq 359 aa
MLKELFVNLTILITFNYLFTHLFKERLVHKKDSISFQAVKGLACGLLGVILMVFGFTYQH
SIIDLRNIPIMIAALYGGWVSTATALAMITAGRLLITMNTSALYSVIIICIAAIPSLIVS
RRKKVQLKHAFYLLIITNSLISFSFYFLIDLHSYELHLYFWIISIAGGMLSLYIIDHETN
AHLLFKQYKFQAHFDFLTGVYNRRKFEETTKALYQQAADTPHFQFALIYMDIDHFKTIND
QYGHHEGDQVLKELGLRLKQTIRNTDPAARIGGEEFAVLLPNCSLDKAARIAERIRSTVS
DAPIVLTNGDELSVTISLGAAHYPNNTEQPGSLPILADQMLYKAKETGRNRVCFSEKKE
NT seq 1080 nt   +upstreamnt  +downstreamnt
ttgctgaaagaactgtttgtaaatttgaccattttaatcacatttaattatctcttcacc
cacctgtttaaagaaaggctagtacataaaaaagacagcatatcctttcaagctgttaaa
ggactggcctgcggtttgctcggggttattctgatggtttttggatttacctatcagcat
tcaattattgatcttcgaaatatccctattatgattgccgctctttatggaggctgggtt
tcaacggcaacggccctggccatgatcactgcaggccgcttgctgattacgatgaacaca
tctgcactatactcggttattatcatttgtatcgctgccattccgtcactcattgtttct
agaagaaaaaaagttcaactaaaacatgctttctatcttttaataatcacaaatagcttg
atctccttttccttttattttcttatagatttacattcatacgaacttcatttgtatttt
tggatcatatcaatagcgggcggcatgctcagtttatatattattgatcatgaaacaaat
gcacatcttctttttaaacaatataagtttcaggcgcactttgactttttaacaggcgtg
tataaccgaagaaaatttgaagaaaccacaaaagctctgtatcagcaggcggccgatacc
ccgcattttcaatttgcactgatttatatggatatcgatcattttaagaccatcaatgac
caatatggccatcatgaaggagatcaggtgctcaaagagctagggttacgtctgaagcag
accatccgaaatactgatcctgccgctcggatcggcggtgaagaatttgccgtgctcctg
ccgaactgttctcttgataaagcagcccggatcgctgaacggatcaggagcactgtaagt
gatgcaccgattgtattaacaaacggcgacgagctttcagttacgatatcactaggggcc
gctcattaccccaataatacggaacagccaggatccttgcccattcttgccgatcaaatg
ctttacaaagcgaaagaaacgggacggaacagagtgtgtttttcagaaaaaaaagaatga

DBGET integrated database retrieval system