KEGG   Bacillus subtilis subsp. subtilis 168: BSU09130
Entry
BSU09130          CDS       T00010                                 

Symbol
tcyP
Name
(RefSeq) L-cystine uptake protein TcyP
  KO
K06956  uncharacterized protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99997 Function unknown
    BSU09130 (tcyP)
SSDB
Motif
Pfam: SDF
Other DBs
NCBI-GeneID: 939257
NCBI-ProteinID: NP_388794
Pasteur: BG11590
BSORF: BG11590
UniProt: P54596 A0A6M3Z8T8
Position
986986..988377
AA seq 463 aa
METLLVVLHVFILFLLILGLFVMQKKHVSFSKRVFTALGLGIVFGFALQLIYGPTSNIVI
QTADWFNIAGGGYVKLLQMVVMPLVFISILGAFTKLKLTKNLGKISGLIIGILVATTAVA
AAVGIASALSFDLQAIQVDQGSTELSRGQELQQKSEDMTAKTLPQQIVELLPGNPFLDFT
GARPTSTIAVVIFAAFLGVAFLGVKHKQPEQAETFKKLVDAVYAIVMRVVTLILRLTPYG
VLAIMTKTIATSDLDSILKLGMFVIASYAALITMFIIHLLLLTFSGLNPVIYLKKAVPVL
VFAFTSRSSAGALPLNIKTQRSMGVPEGIANFAGSFGLSIGQNGCAGIYPAMLAMMIAPT
VGQNPFDPVFIITVIAVVAISSFGVAGVGGGATFAALLVLSSLNMPVALAGLLISIEPLI
DMGRTALNVSGSMTSGLITSKVTKEIDQGAFHDQSRVIEAEEA
NT seq 1392 nt   +upstreamnt  +downstreamnt
ttggagactttactggttgtattacatgtatttattttatttttacttatcttagggctc
tttgttatgcagaaaaaacatgtttccttctctaaacgtgtatttactgcgctggggctg
gggattgtattcggatttgcgcttcagctgatttacggcccgacttcaaatatagtcatt
caaacagccgactggtttaatattgccgggggcggatatgtcaaattgcttcagatggtt
gtcatgccgctcgtctttatttcgattctcggcgcctttacaaagctgaagctgacaaaa
aatcttgggaaaatcagcggtttgattatcgggattttagtagcaacaacagcagttgct
gcagctgtcggtatcgcgtccgcgctttcatttgatctgcaggcgattcaggttgaccaa
ggaagtacagagctttcacggggacaggagcttcagcagaaatcagaggatatgacagcg
aaaacgctgccgcagcagattgttgaactgctgcctggaaacccgtttttagattttacg
ggagctagaccgacttcaacgatcgctgtcgttatttttgccgctttccttggagtggca
ttcctcggcgtaaaacacaaacagccggaacaggcagaaacatttaaaaaactggttgat
gccgtttatgccattgtcatgcgtgttgtcacactcattttgagactgacgccttatggg
gtgctggccatcatgacaaaaacaattgcaacgagtgatcttgacagcattctaaaactg
ggcatgttcgtgattgcatcatatgccgcgttaatcactatgtttatcattcatttgctg
ctgctgacgttcagcggcttgaatccggtgatttatttgaaaaaagcggtgcctgtactt
gtatttgcatttacgtcaaggtctagcgcaggtgctttaccgctgaatattaaaacacag
agaagcatgggtgtaccggagggaatcgcaaactttgccggttcgttcggtctttcgatc
ggccaaaatggatgtgccggcatttatcctgcgatgctggcgatgatgattgctccgact
gtcggccaaaatccatttgacccggtgtttattatcactgttatcgcagtcgttgccatc
agctccttcggggttgccggagtcggcggcggagcgacattcgcggcgcttcttgtttta
tcatcattaaacatgcctgtcgcgctcgccggtttgttaatctcaattgaaccgttaatc
gacatggggcgtactgctttgaatgtcagcggaagcatgacatccggtcttattacaagt
aaggtcacaaaagaaattgatcaaggggcatttcatgatcaatccagagtgattgaagct
gaagaagcgtaa

DBGET integrated database retrieval system