KEGG   Bacillus subtilis subsp. subtilis 168: BSU09150
Entry
BSU09150          CDS       T00010                                 

Symbol
yhcN
Name
(RefSeq) lipoprotein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: Spore_YhcN_YlaJ
Other DBs
NCBI-GeneID: 939739
NCBI-ProteinID: NP_388796
Pasteur: BG11592
BSORF: BG11592
UniProt: P54598 A0A6M4JEF2
Position
989022..989591
AA seq 189 aa
MFGKKQVLASVLLIPLLMTGCGVADQGEGRRDNNDVRNVNYRNPANDDMRNVNNRDNVDN
NVNDNVNNNRVNDDNNNDRKLEVADEAADKVTDLKEVKHADIIVAGNQAYVAVVLTNGNK
GAVENNLKKKIAKKVRSTDKNIDNVYVSANPDFVERMQGYGKRIQNGDPIAGLFDEFTQT
VQRVFPNAE
NT seq 570 nt   +upstreamnt  +downstreamnt
atgtttggaaaaaaacaagtccttgcgtctgtgcttcttatccctttgcttatgactggc
tgcggtgtagccgaccaaggtgagggcagacgtgataataatgatgtaagaaacgtaaat
tatcgaaatccggccaatgacgatatgcggaatgtaaacaatcgggataacgttgacaac
aatgttaatgataatgtcaataacaatcgtgtaaatgacgataataacaacgaccgaaaa
cttgaggttgctgatgaagcagctgataaagtaacagacctaaaagaagtaaagcatgcc
gatatcattgtggctggaaatcaagcctacgttgcagtcgttttaaccaatggaaataaa
ggtgcagtagaaaacaatctgaagaaaaaaatagccaaaaaggtaagatctactgacaaa
aacattgataatgtttacgtttcagctaaccctgattttgtagagcgtatgcaaggatat
ggaaagcgtattcaaaatggtgacccaatcgccggattatttgatgaatttacacaaact
gtacagcgtgtattccctaacgctgaataa

DBGET integrated database retrieval system