KEGG   Bacillus subtilis subsp. subtilis 168: BSU09165
Entry
BSU09165          CDS       T00010                                 

Symbol
yhcO
Name
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: TPM_phosphatase Peptidase_M9 Peptidase_MA_2 DUF6055
Other DBs
NCBI-GeneID: 936243
NCBI-ProteinID: NP_388797
UniProt: P54599 A0A6M3Z8V1
Position
989712..990680
AA seq 322 aa
MRDGIGKRAASALFLCGVLVMLAVSSAIVSSAMYILSFPGQASGITKEQVTKHMKKESFK
QADIYYTSKEKSLLPLTKETLEYAVSINQIMIGYSNQKPIDIIFFPNEKQMEAYSGLLDV
VGFYSEREQLIGLLPEEKKKLLEGDEVAVYLYQRLLIHEYSHHAFHQKLKELETDPDEFP
LWFHEGLSEWIANYELLIDPITFSVVPFDRLQTDRDWQEARAEYDTDVYLQSFYMIDELT
DKYGKDIISEMIKETAKKGDFEKGFKSATKESLDQFEKDFKKKFEKNSAALDSIYPMPLL
LVKSLLTHSALCRRHLSLGRGE
NT seq 969 nt   +upstreamnt  +downstreamnt
ttgcgggatggcataggaaagcgtgcggcatccgctctattcctgtgcggagtccttgtg
atgctggctgtaagctcagccatcgtatcaagcgcgatgtatatcctgtcttttccaggt
caggcatctggaataacaaaagaacaagtgacgaagcacatgaagaaagagtcattcaaa
caggccgatatttattacacttctaaggaaaagtccttactgccattgacgaaagaaacg
cttgaatatgcggtcagtattaatcagattatgattggatattcgaatcaaaagcctatt
gacattattttttttcctaatgaaaaacagatggaggcttactccggtttattggatgta
gttggtttttattctgaacgggagcagctgatcggattgttgcctgaagagaaaaagaaa
ctgttagaaggggacgaggtagcggtttatttgtaccagagattgttgattcatgaatac
tcgcaccatgcgtttcaccagaaattgaaggagcttgagacggatcccgatgagtttccg
ttatggtttcatgaagggttaagcgagtggattgcgaactatgaattgctcatagatccg
atcacgttttctgtcgtgccctttgaccgtttgcagactgatcgagactggcaggaagct
agagccgaatatgacactgatgtctatttgcaaagcttttatatgatcgatgagctgacg
gacaaatacgggaaagacattatttcagaaatgattaaggaaacggcaaaaaaaggggac
tttgaaaaagggtttaaatcagcaacaaaggaaagtcttgatcaatttgaaaaagatttt
aagaaaaaatttgaaaaaaacagtgcggcattggatagtatctatccaatgcctttgtta
ttagtgaagtccttgctgacccattccgccttgtgtcggaggcatttgtccttgggcagg
ggcgaatga

DBGET integrated database retrieval system