KEGG   Bacillus subtilis subsp. subtilis 168: BSU09180
Entry
BSU09180          CDS       T00010                                 

Symbol
yhcQ
Name
(RefSeq) spore coat protein F
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: Coat_F
Other DBs
NCBI-GeneID: 936236
NCBI-ProteinID: NP_388799
Pasteur: BG11595
BSORF: BG11595
UniProt: P54601 A0A6M4JGB8
Position
complement(990612..991265)
AA seq 217 aa
MDQFNQQQQSQMNKGIPGKPHKNHGGHEMFDMHEVLSGTLTVLDQFMMLRQFCKDQELLN
ILDRQHQFITSQYNITAECFKTGSEPSQKTATYMMKEDNQTVYGMQPSQPKKPVQSMNDI
DDSIISRQMLCAIKAQASMLTMASLEMTNPAVRRVLSAQIQEYVEMAFEIFLYQNKHGYY
QVPQLDAQDMEQLRNSFAPAQGQMPPTQGGMGQQGLH
NT seq 654 nt   +upstreamnt  +downstreamnt
ttggatcagttcaatcagcagcagcaatcccaaatgaacaaaggtattcctggcaaaccg
cataaaaaccacggcggacatgaaatgtttgatatgcatgaggtgctttccggaacactt
actgtgcttgatcagtttatgatgctgagacaattctgtaaggatcaagaattactaaac
atccttgatcgtcaacatcaattcatcacatctcaatacaatataactgcagaatgcttc
aaaacaggaagcgaaccttcacaaaaaacagcaacttatatgatgaaggaagacaaccag
actgtttacggcatgcagccgtcacagcctaaaaaacctgttcaatccatgaatgatatt
gatgacagcatcatcagccgacaaatgctttgcgcgattaaagcacaagcttctatgctg
acgatggcttctctggaaatgacaaatccggccgtaagacgcgtactgtctgcgcaaatt
caggagtatgttgaaatggcatttgaaattttcctataccaaaacaaacacggctattac
caggttcctcagcttgatgcgcaggatatggaacagctgcgaaattcattcgcccctgcc
caaggacaaatgcctccgacacaaggcggaatgggtcagcaaggacttcactaa

DBGET integrated database retrieval system