KEGG   Bacillus subtilis subsp. subtilis 168: BSU09190
Entry
BSU09190          CDS       T00010                                 

Symbol
yhcR
Name
(RefSeq) endonuclease
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: 5_nucleotid_C SNase DUF6359 Metallophos tRNA_anti-codon Gram_pos_anchor DUF5689 Rep_fac-A_3
Other DBs
NCBI-GeneID: 936241
NCBI-ProteinID: NP_388800
Pasteur: BG11596
BSORF: BG11596
UniProt: P54602 A0A6M4JGV6
Position
991348..995001
AA seq 1217 aa
MLSVEMISRQNRCHYVYKGGNMMRRILHIVLITALMFLNVMYTFEAVKAAEPQQPISIEK
AIQQKEGQALVEGYAVGQAVSPQHYKLTSPFSNDYNVALADRKNKTSPEHILPVQIPSAF
RSQFGLQTNPLLLGKKITVQGKLENYFNTTGLKNVQSMNVTDDTKTPPAEQQVTINEARG
RLNEEVTIKGIITADQNAIGGGKLSTFLQDETGGINIYSPSPEQFPELKEGMDVTVTGKI
TSYQGLKEIVPNSSGIKINQSNQSLPAPKHLTINELINGSLGDQYEGRLVKLTAFVSSIP
SSPAGGGYNVTMIDDDHHAMTLRVMNETGVINELDEGKWYEFTGVLSRYQTFQLLPRKSA
DLKLLEEQPAPPSAEGEYEGIVDRVVDGDTIHLKSPVLGTTKIRFVNVDAPETYHTPKND
ADENQLRFGKKASDYLKTVLSPGDKITVKVGSEAKDSYGRLLGQVITESGSNVNLELVKN
GYAPTYFIWPVDNEEDYQQFQAAVAAAKKDQKGIWNENDPLMEMPFEFRAREQGKGLTRY
VGDSSNKTYVQPADWKKIAVENRIFFASASEAESAGYKKRQTAPQEHVPLRILSMNDLHG
KIDQQYELDLDGNGTVDGTFGRMDYAAAYLKEKKAEKKNSLIVHAGDMIGGSSPVSSLLQ
DEPTVELMEDIGFDVGTVGNHEFDEGTDELLRILNGGDHPKGTSGYDGQNFPLVCANCKM
KSTGEPFLPAYDIINVEGVPVAFIGVVTQSAAGMVMPEGIKNIEFTDEATAVNKAAEELK
KKGVKAIAVLAHMSAEQNGNAITGESADLANKTDSEIDVIFAAHNHQVVNGEVNGKLIVQ
AFEYGKAIGVVDVEIDKTTKDIVKKSAEIVYVDQSKIEPDVSASAILKKYETIAEPIISE
VVGEAAVDMEGGYSNDGDTPLGNLIADGMRAAMKTDFALMNGGGIREALKKGPITWGDLY
NIQPFGNVLTKLEIKGKDLREIINAQISPVFGPDYSISGFTYTWDKETGKAVDMKMADGT
EIQPDATYTLTVNNFMATATGAKYQPIGLLGKNPVTGPEDLEATVEYVKSFDEPIAYTKE
GRIKLAEASDIEDPVTEDPITEEPGDDPGTEDPIKEDPRPGEDLPDIKETPGTAPVHQLP
PSAISRFNEIPINNTKTADTANSISTLPLQTETAESGSDHQLPDTSAGYYNFMVIGAAVT
LSGTYLYVRRKRSASRT
NT seq 3654 nt   +upstreamnt  +downstreamnt
atgctgtctgtcgaaatgataagcagacaaaatcgttgtcattatgtgtataagggagga
aatatgatgaggcgtattctgcatattgtgttgatcacggcattaatgttcttaaatgta
atgtacacgttcgaagctgtaaaggcagctgaaccgcaacagcctatatcgattgagaag
gcaatacagcaaaaagaaggacaggcacttgtcgaaggatatgcagtcggccaggctgtt
tccccgcagcattataaactgacaagccctttttcaaatgattataatgttgcgctggca
gaccgtaaaaacaaaacatcgcccgaacacatccttcctgtgcaaatcccctccgccttc
agaagccaatttgggctgcaaaccaatccgcttcttcttgggaaaaagataacggttcaa
ggaaagcttgaaaattactttaacacgacaggacttaaaaacgttcagtcgatgaacgta
accgatgacacaaaaactccgccggctgaacagcaagtgaccataaatgaagcacgggga
aggctgaatgaagaagtaacgataaaagggatcattacagctgatcaaaacgcaatcgga
ggcgggaagctgtcgacctttttgcaagatgaaaccggaggcattaacatttattcgcca
tcccctgaacaatttcccgaattaaaagagggtatggatgtcacggtgacagggaaaatc
acgtcttaccaggggctgaaagaaatcgttccaaactcatcaggcatcaaaatcaaccag
tcaaatcaatccctccccgcccccaaacacttaacaatcaatgaacttattaacggcagc
ctaggtgatcagtatgaaggacgccttgtgaaactaaccgcttttgtttcctcaattcca
agttctcctgccggcggcggttacaatgtaacaatgattgatgacgaccatcatgcaatg
acgctccgggttatgaatgaaacaggggtgataaacgagcttgatgagggcaaatggtat
gaatttaccggtgtgttaagcagataccaaacctttcagctgcttccgcgaaaatcggct
gacctgaagctgcttgaagagcagcccgcacctccgtctgcagagggagaatatgaaggg
attgttgaccgggtagttgacggcgataccattcatcttaaatctccggtgcttggaacg
acaaaaatccggtttgtaaatgtagatgcacccgaaacatatcacacaccaaaaaatgac
gcagatgaaaatcaattaagatttggcaaaaaagcatctgactatctaaaaacggttctg
tccccgggtgataaaattactgtcaaggtcgggagtgaagccaaggacagctatggcaga
ttgctcggacaagtcataaccgaatcaggttcaaacgtgaacttagagcttgtaaaaaac
ggctatgctccgacgtattttatttggccggttgacaatgaagaggattatcagcaattt
caggccgcagtagccgctgcaaaaaaagatcaaaaaggaatttggaatgaaaacgatccc
ctcatggaaatgccgtttgaattcagagccagagagcaagggaaaggcctgacaagatat
gtgggggactcgtcgaataaaacatatgtgcagccagctgactggaagaagatagctgtg
gaaaacagaattttcttcgcctcagcaagtgaagcggagagcgcgggatataaaaaaagg
caaacggcacctcaagaacatgtgccgcttagaattctcagcatgaatgatttgcatggc
aaaatcgatcagcaatatgagcttgatcttgatggaaatggaactgtagacggcacgttt
ggacgcatggattatgccgccgcatatttaaaagaaaaaaaggctgaaaagaaaaactcg
ctgattgtgcacgcgggagatatgatcggcggaagctctccagtttcctctcttcttcag
gatgaaccgactgtagaactgatggaggacatcggatttgatgtcggaaccgtgggaaac
cacgaatttgatgaaggcacggatgaacttctgaggatcttaaatggcggtgatcatccg
aaaggcacaagcggatatgatggacagaactttccccttgtatgtgccaattgtaaaatg
aaatcaactggagagccctttttgccggcttacgacatcattaatgtggagggcgtaccc
gttgcttttatcggagttgtcacacagtcggcagctggcatggttatgcctgaaggaata
aaaaatatcgagtttacagatgaagcaacagcggtgaataaggcggccgaagagctcaag
aaaaaaggcgtgaaggccatcgcggttctcgcacatatgtcagctgaacaaaacggcaac
gccattaccggtgagtctgctgatcttgcaaacaaaacagattctgaaattgacgtgatt
tttgccgcgcataatcatcaggttgttaacggtgaagtgaatggaaaactgattgttcaa
gcgtttgaatatggaaaagcgataggtgtcgttgatgtagagatcgataaaacgacaaaa
gacattgtcaaaaagtccgcggaaatcgtatatgttgatcaaagtaaaatcgaaccggat
gtcagcgcgtcagccattttaaagaaatacgaaacaattgcggaaccgattatcagcgag
gtagtcggcgaagccgctgttgatatggaaggggggtattcaaatgacggcgatacacct
cttggaaacctgattgcggatggtatgagagctgccatgaaaacggattttgcccttatg
aatggcggcggcatacgtgaagcgctgaagaagggtccaattacgtggggagatctttac
aatattcagccgtttggaaatgtgttaacgaagcttgagattaaaggaaaagatttaaga
gagattatcaatgcgcaaatctcgccggtttttgggcctgactacagcatcagcgggttt
acgtatacgtgggataaagaaaccggaaaagcagttgatatgaaaatggcagatggcacc
gagatccagcccgatgccacatatacattgaccgtcaacaactttatggcgacggcgaca
ggagccaaatatcagccaatcggactgctgggaaaaaatccggtgacagggcctgaggat
ttggaagcgacagttgagtacgtgaagagttttgatgagccaattgcgtatacaaaagag
ggaagaattaagcttgctgaagccagtgatattgaagaccctgtaacagaagacccgata
acggaagagcctggagatgatccggggacggaggatccgattaaagaggatccaaggcca
ggtgaagatttgcctgatataaaagaaactccgggaacagcaccggttcatcagcttccg
ccttcagccatttcgagattcaatgaaataccaatcaacaacacaaaaaccgctgatact
gctaatagcatcagcacattgccgttacaaaccgagactgcggaaagcgggtctgatcat
cagcttccggatacgtcagcgggctactataactttatggtaatcggtgcggcggtgaca
ttgtcaggaacttatctatatgtcagaagaaaaaggagcgcctccagaacgtga

DBGET integrated database retrieval system