KEGG   Bacillus subtilis subsp. subtilis 168: BSU09200
Entry
BSU09200          CDS       T00010                                 

Symbol
yhcS
Name
(RefSeq) hypothetical protein
  KO
K07284  sortase A [EC:3.4.22.70]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:bsu01002]
    BSU09200 (yhcS)
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:bsu01011]
    BSU09200 (yhcS)
Enzymes [BR:bsu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.70  sortase A
     BSU09200 (yhcS)
Peptidases and inhibitors [BR:bsu01002]
 Cysteine peptidases
  Family C60
   BSU09200 (yhcS)
Peptidoglycan biosynthesis and degradation proteins [BR:bsu01011]
 Peptidoglycan biosynthesis and degradation
  Sortase
   BSU09200 (yhcS)
SSDB
Motif
Pfam: Sortase
Other DBs
NCBI-GeneID: 939748
NCBI-ProteinID: NP_388801
Pasteur: BG11597
BSORF: BG11597
UniProt: P54603 A0A6M3ZE42
Position
994998..995594
AA seq 198 aa
MKKVIPLFIIAAGLVIAGYGGFKLIDTNTKTEQTLKEAKLAAKKPQEASGTKNSTDQAKN
KASFKPETGQASGILEIPKINAELPIVEGTDADDLEKGVGHYKDSYYPDENGQIVLSGHR
DTVFRRTGELEKGDQLRLLLSYGEFTYEIVKTKIVDKDDTSIITLQHEKEELILTTCYPF
SYVGNAPKRYIIYGKRVT
NT seq 597 nt   +upstreamnt  +downstreamnt
gtgaaaaaagttattccactattcatcattgctgccggcctagtgatcgcaggctatgga
ggctttaaattgatcgatacgaatacgaaaacggaacagacattaaaagaagcaaagctg
gcggctaaaaagccgcaggaagcttcggggacgaaaaatagcacagatcaagcaaagaac
aaagcatcatttaagcctgagaccggccaagcgagcggcattttagaaataccgaaaatc
aatgcagagcttccgatcgtggagggcaccgatgctgatgatttagaaaaaggtgtcggg
cattacaaggacagctattatcctgatgaaaacggacaaattgtgctgtcagggcatcgg
gataccgtgtttcgccggacgggagagctggaaaagggggatcagctccgtcttctcctg
tcatatggagaattcacatatgaaattgtaaaaacaaaaattgtcgataaggatgacaca
tctattatcacgctccagcatgaaaaggaagagctgattctgacgacctgctatccgttt
tcatacgtcggaaatgccccgaagcgctatattatatatggaaaacgagtgacttaa

DBGET integrated database retrieval system