KEGG   Bacillus subtilis subsp. subtilis 168: BSU09210
Entry
BSU09210          CDS       T00010                                 

Symbol
yhcT
Name
(RefSeq) RNA pseudouridine synthase YhcT
  KO
K06180  23S rRNA pseudouridine1911/1915/1917 synthase [EC:5.4.99.23]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:bsu03009]
    BSU09210 (yhcT)
Enzymes [BR:bsu01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.23  23S rRNA pseudouridine1911/1915/1917 synthase
     BSU09210 (yhcT)
Ribosome biogenesis [BR:bsu03009]
 Prokaryotic type
  rRNA modification factors
   23S rRNA modification factors
    BSU09210 (yhcT)
SSDB
Motif
Pfam: PseudoU_synth_2 S4 DUF1347
Other DBs
NCBI-GeneID: 936253
NCBI-ProteinID: NP_388802
Pasteur: BG11598
BSORF: BG11598
UniProt: P54604 A0A6M4JGC1
Position
complement(995624..996532)
AA seq 302 aa
MNQKGRGLEILINEKQDGQWLFSVLKTALKASKPVIQDWMSHQQIKVNHESVLNNMIVKK
GDRVFIDLQESEASSVIPEYGELDILFEDNHMLIINKPAGIATHPNEDGQTGTLANLIAY
HYQINGETCKVRHVHRLDQDTSGAIVFAKHRLAHAILDQQLEKKTLKRTYTAIAEGKLRT
KKGTINSPIGRDRSHPTRRRVSPGGQTAVTHFKVMASNAKERLSLVELELETGRTHQIRV
HLASLGHPLTGDSLYGGGSKLLNRQALHANKVQAVHPITDELIVAEAPFPADMKNLCRTY
FS
NT seq 909 nt   +upstreamnt  +downstreamnt
atgaaccaaaaaggcagagggcttgagatcctcatcaatgaaaaacaggacggccaatgg
ctgttttccgtactcaaaacagcgctcaaagcttctaaaccagtgatacaagactggatg
tcccatcaacagataaaggtcaatcacgaatccgtcttaaacaatatgattgtaaaaaag
ggagaccgcgtgttcattgatcttcaggaaagtgaagcatcttcggtcattccggagtat
ggcgagcttgatattttatttgaggacaatcatatgctcatcatcaataaacccgctggc
atcgcgacgcatccgaatgaggatgggcaaaccggcacactggctaatttgatcgcgtat
cattatcagataaatggcgaaacatgtaaggtgcgccacgtccatcgtcttgatcaggat
acatctggcgctatcgtttttgccaagcatcgtttggcacacgccatcttagaccagcag
ttagagaaaaagacgctgaagcgtacgtataccgctatcgctgaaggtaagctacggacg
aaaaaagggacaattaattcaccgatcggcagagaccgctcacacccgacaagacgccgg
gtttcaccaggcgggcaaacagccgtcactcatttcaaggtaatggccagcaatgcgaaa
gaacggctgtcgctcgttgaattagagctggaaacaggcagaacacaccaaatccgtgtt
catctggcgagcctcggccatccgttgacaggagactcgctttacggaggcgggagcaag
ctgctaaacaggcaggcactgcacgccaataaagtacaagcggttcacccgataacagac
gagctcatagttgctgaagcccctttccctgctgatatgaaaaacctttgccgcacatat
ttttcatga

DBGET integrated database retrieval system