KEGG   Bacillus subtilis subsp. subtilis 168: BSU09220
Entry
BSU09220          CDS       T00010                                 

Symbol
yhcU
Name
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: DUF5365
Other DBs
NCBI-GeneID: 936261
NCBI-ProteinID: NP_388803
Pasteur: BG11599
BSORF: BG11599
UniProt: P54605 A0A6M4JHR8
Position
996643..997038
AA seq 131 aa
MARKVIDVRIVNAATAEQESFIKELSMELIHDVFPLYFSELDIQRFKKKGVLSLNNHYYQ
GTLKEAFQIMACLQMIHIILTKPSPHSDLSDQAIFEKNSKMLNDFGIYFPFAFSDFQKKT
NKAFFGQRRLI
NT seq 396 nt   +upstreamnt  +downstreamnt
atggcaagaaaggtgattgacgtgagaattgtgaacgcagcaactgcagaacaggagagc
tttatcaaggagctgtctatggagctgatccatgatgtatttcctctttatttctccgaa
ctggacattcagcgctttaaaaagaaaggcgttctgtctttaaataaccattattaccaa
ggaacattaaaagaagcatttcaaattatggcttgtctgcaaatgatacatattatcctg
accaagccttcgccgcactctgatttgagtgatcaggcgatttttgaaaaaaacagcaag
atgctgaatgattttgggatttattttccgtttgctttttctgactttcaaaagaagact
aacaaagcctttttcggtcaaagaaggctgatataa

DBGET integrated database retrieval system