KEGG   Bacillus subtilis subsp. subtilis 168: BSU09240
Entry
BSU09240          CDS       T00010                                 

Symbol
yhcW
Name
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: HAD_2 Hydrolase Hydrolase_like HAD
Other DBs
NCBI-GeneID: 936244
NCBI-ProteinID: NP_388805
Pasteur: BG11601
BSORF: BG11601
UniProt: P54607 A0A6M3Z8U7
Position
997724..998386
AA seq 220 aa
MIKALIFDFDGLILDTETHEYEVLQEIFEEHGSVLPLSVWGKVIGTAAGFRPFEYLEEQI
GKKLNHEELTQLRRERFAKRMESEKARPGVEAYLNAAKDLGLKIGLASSSDYKWVSGHLK
QIGLFDDFEVIQTADDVEEVKPNPELYLLAAKNLGVSPAECLAFEDSVNGSIAAKRAGMK
CVIVPNKVTGTLMFEDYDHRLESMAEMELALLLDHLNSQN
NT seq 663 nt   +upstreamnt  +downstreamnt
gtgattaaagcgttaatttttgattttgacgggcttattctagatacagaaacacacgaa
tatgaggttcttcaggaaatatttgaagagcacggctcagtgctgccgctatctgtctgg
ggaaaggtcatcggaactgctgcgggtttccggccttttgaatatttagaagagcagatc
gggaaaaagctgaaccatgaagagctcacacaattgagaagagagcggtttgccaaacgc
atggaatcagaaaaagcgagacctggtgtcgaagcgtatttgaatgcggcaaaggattta
ggcttaaaaataggccttgcctccagctctgattataaatgggtgtccggccatttgaag
caaatcggcctgtttgatgattttgaagttattcaaacggcggatgatgtggaagaggtg
aagccgaatcctgaactctatttattggcggcaaagaacctgggggtatcgccagcggaa
tgtctcgcgtttgaggattctgtcaatggttcgattgctgcgaaacgtgcaggcatgaag
tgtgtcattgtcccgaataaagtaacgggtaccttgatgtttgaagactatgatcacagg
cttgaatcaatggcggagatggagctcgccctattgcttgatcatctgaactcacaaaac
tag

DBGET integrated database retrieval system