KEGG   Bacillus subtilis subsp. subtilis 168: BSU09250
Entry
BSU09250          CDS       T00010                                 

Symbol
yhcX
Name
(RefSeq) hydrolase
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: CN_hydrolase Acetyltransf_1 Acetyltransf_7
Other DBs
NCBI-GeneID: 939265
NCBI-ProteinID: NP_388806
Pasteur: BG11602
BSORF: BG11602
UniProt: P54608 A0A6M3Z8V7
Position
998402..999943
AA seq 513 aa
MSEKLDLTRFEKKMVIRNIEEKDIDKIIDLQKDCFPGMEPWKREHLISHLEHFPEGQFCA
EFEGEIIGSCSSLLINFDEYDDRHTWQDITDDGYITNHNPDGLNMYGIEVMVHPKYRRMK
IGHRLYEARKDLARRLNLKSIIIGGRIPNYHKYAEEMTAREYVEQVTRHQIYDPVLSFQL
MNGFTLMRINPNYLPDDTASIKYATLMEWNNVDYLPQQTKRYYKSAFPVRICVIQYEMKK
IYSFEEFANQVEYYVDVASDARSDFAVFPEIFTTQLMSFLEERSPSLAVQRITEYTEDYI
SLFTDLAVKYNVNIIGGSHFVEEEGKIYNIAYLFRRDGTIEKQYKLHITPNERKWWGISA
GDQVRVFDTDCGKIAIQICYDIEFPELARIAADKGAKIIFTPFCTEDRQGYLRVRYCSQA
RAVENQIYTVISGTVGNLPQTENMDIQYAQSGIFAPSDFEFARDGIVGETNPNIEMVVIG
DVDLEILRRQRQNGTVRQLKDRRRDIYHIQYKK
NT seq 1542 nt   +upstreamnt  +downstreamnt
ttgtctgagaaattagatttgacccggtttgaaaagaaaatggttatccgcaatatcgaa
gagaaagacatcgacaagattatcgatcttcaaaaggactgctttccaggaatggagcct
tggaagcgggagcatttaatcagccatttggagcattttccggaaggacagttttgtgca
gaattcgaaggtgaaattatcggttcgtgctcaagtctcctgattaactttgatgaatat
gatgaccgccatacgtggcaggacattacagatgacggttatatcaccaaccataatcct
gacggcttgaatatgtacggaattgaagtcatggtgcacccgaaatacagacgaatgaag
atcggccaccgtttgtacgaggcgagaaaggacttagccagacgcttaaacctgaaaagc
atcatcataggcggacggattccaaactatcacaaatatgcagaggaaatgacagcgaga
gagtatgttgaacaggtgacacgccaccaaatttacgatccggttctttcttttcagctg
atgaacggctttacccttatgcgaattaacccgaactatctcccggatgatacagcttcg
atcaagtatgcgacgctgatggaatggaataatgtcgattatctaccgcagcagacaaaa
cgctattataaatcggcgttccctgttagaatttgtgtgatccaatacgaaatgaagaaa
atttattcctttgaggaatttgcgaatcaagtagaatactatgtcgatgttgcttccgac
gcaagatctgattttgcggtgttcccggaaattttcacaacccagctgatgtccttcctt
gaggaacggtcaccgagcttggcggtgcagagaattaccgagtatacagaagattacatc
agcctgtttactgacttggctgtgaagtataacgtcaacattatcggcggatctcatttc
gtcgaagaggaaggcaagatctataatatcgcttacctgttcagacgggacggaacgatc
gagaagcaatacaaactccatattacgccgaatgaacgcaaatggtgggggatcagcgca
ggagaccaagttcgcgtgtttgatacggactgcgggaaaatcgcgatccagatctgttat
gacattgaatttcctgagcttgcccggattgcggctgataaaggagccaaaatcatcttt
acgccattttgtacagaagaccgtcaaggctatctgcgtgtcagatactgttcgcaggct
agagcggttgaaaatcaaatttatacggttatctctggaacggtcggaaaccttccgcaa
acggaaaacatggatatccaatacgcccagtcaggcatctttgccccgtctgattttgaa
ttcgcccgagacggcattgtcggcgaaacaaacccgaatattgaaatggtcgtcatcggc
gatgttgacctggaaattctcagaagacagcgccaaaacggtacagtgcgccagctaaaa
gacagacgacgtgatatttatcatattcaatataaaaaataa

DBGET integrated database retrieval system