KEGG   Bacillus subtilis subsp. subtilis 168: BSU09260
Entry
BSU09260          CDS       T00010                                 

Symbol
yhxA
Name
(RefSeq) aminotransferase YhxA
  KO
K03851  taurine-pyruvate aminotransferase [EC:2.6.1.77]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00430  Taurine and hypotaurine metabolism
bsu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    BSU09260 (yhxA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:bsu01007]
    BSU09260 (yhxA)
Enzymes [BR:bsu01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.77  taurine---pyruvate aminotransferase
     BSU09260 (yhxA)
Amino acid related enzymes [BR:bsu01007]
 Aminotransferase (transaminase)
  Class III
   BSU09260 (yhxA)
SSDB
Motif
Pfam: Aminotran_3 Beta_elim_lyase
Other DBs
NCBI-GeneID: 939742
NCBI-ProteinID: NP_388807
Pasteur: BG10184
BSORF: BG10184
UniProt: P33189 A0A6M3Z8V8
Position
1000364..1001716
AA seq 450 aa
MEMMGMENIQQNQGLKQKDEQFVWHAMKGAHQADSLIAQKAEGAWVTDTDGRRYLDAMSG
LWCVNIGYGRKELAEAAYEQLKELPYYPLTQSHAPAIQLAEKLNEWLGGDYVIFFSNSGS
EANETAFKIARQYHLQNGDHSRYKFISRYRAYHGNTLGALSATGQAQRKYKYEPLSQGFL
HAAPPDIYRNPDDADTLESANEIDRIMTWELSETIAGVIMEPIITGGGILMPPDGYMKKV
EDICRRHGALLICDEVICGFGRTGEPFGFMHYGVKPDIITMAKGITSAYLPLSATAVKRD
IFEAYQGEAPYDRFRHVNTFGGSPAACALALKNLQIMEDEQLIQRSRDLGAKLLGELQAL
REHPAVGDVRGKGLLIGIELVKDKLTKEPADAAKVNQVVAACKEKGLIIGKNGDTVAGYN
NVIQLAPPFCLTEEDLSFIVKTVKESFQTI
NT seq 1353 nt   +upstreamnt  +downstreamnt
atggagatgatggggatggaaaacattcagcaaaatcagggattaaagcaaaaagatgag
caatttgtgtggcatgccatgaagggagcgcatcaagcggacagcctgatagcccagaag
gccgaaggggcctgggtaaccgacacagacggacgccgctatttggatgcgatgtccggt
ttgtggtgcgtcaacattggttacggcagaaaggagcttgcggaggctgcctatgagcaa
ctaaaggagctgccttactacccgttaacgcaaagtcacgcacccgcaattcaactggcg
gaaaagctgaatgaatggcttggcggcgattatgttatttttttttccaacagcggatcg
gaagcaaacgaaactgcttttaaaattgcccgccagtaccatctgcaaaacggcgaccac
agccgttataaattcatctcaagatatcgggcataccacggcaatacattgggagcgctc
tcagctaccggacaggcgcagcggaaatataaatacgagcctttgagccaagggttcctg
catgcagctccgccagatatataccggaatcctgatgatgcagacacgcttgaaagcgca
aatgaaatcgaccgcatcatgacatgggaattaagcgaaacgattgccggggtcattatg
gagcccatcattacaggcggaggcatcctaatgccgccggacggatatatgaagaaggtg
gaggacatttgccggcgccacggagcccttttgatttgcgatgaagtgatctgcgggttt
ggacggacaggtgagccgttcgggtttatgcactacggtgtgaagcctgatatcattacg
atggcaaagggaatcacaagcgcgtatctgccattgtcagcgactgctgtgaaacgggac
attttcgaagcgtatcagggggaagctccttatgaccgtttccgccacgtgaacacgttc
ggcggaagcccggctgcctgtgctttggcgttgaaaaacctgcaaattatggaggacgaa
cagctgattcagcgatcccgtgatcttggagcaaagcttttaggtgagcttcaagctctg
agagaacacccggcagtcggggatgttagaggaaaagggctgctgatcggaatcgaactc
gtcaaagacaaattgactaaagagccggctgatgccgccaaagtaaaccaagtggttgcg
gcgtgcaaagaaaaagggctgatcatcggcaaaaacggcgatacagtcgccggctacaac
aatgtcatccagcttgcgccgccattttgcctgacagaagaggacctttcctttatcgtg
aaaacggtgaaagaaagctttcaaacgatataa

DBGET integrated database retrieval system