KEGG   Bacillus subtilis subsp. subtilis 168: BSU09290
Entry
BSU09290          CDS       T00010                                 

Symbol
glpK
Name
(RefSeq) glycerol kinase
  KO
K00864  glycerol kinase [EC:2.7.1.30]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00561  Glycerolipid metabolism
bsu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    BSU09290 (glpK)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bsu04147]
    BSU09290 (glpK)
Enzymes [BR:bsu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     BSU09290 (glpK)
Exosome [BR:bsu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BSU09290 (glpK)
SSDB
Motif
Pfam: FGGY_N FGGY_C BcrAD_BadFG
Other DBs
NCBI-GeneID: 939741
NCBI-ProteinID: NP_388810
Pasteur: BG10187
BSORF: BG10187
UniProt: P18157 A0A6M4JGW5
Position
1003344..1004834
AA seq 496 aa
METYILSLDQGTTSSRAILFNKEGKIVHSAQKEFTQYFPHPGWVEHNANEIWGSVLAVIA
SVISESGISASQIAGIGITNQRETTVVWDKDTGSPVYNAIVWQSRQTSGICEELREKGYN
DKFREKTGLLIDPYFSGTKVKWILDNVEGAREKAEKGELLFGTIDTWLIWKMSGGKAHVT
DYSNASRTLMFNIYDLKWDDELLDILGVPKSMLPEVKPSSHVYAETVDYHFFGKNIPIAG
AAGDQQSALFGQACFEEGMGKNTYGTGCFMLMNTGEKAIKSEHGLLTTIAWGIDGKVNYA
LEGSIFVAGSAIQWLRDGLRMFQDSSLSESYAEKVDSTDGVYVVPAFVGLGTPYWDSDVR
GSVFGLTRGTTKEHFIRATLESLAYQTKDVLDAMEADSNISLKTLRVDGGAVKNNFLMQF
QGDLLNVPVERPEINETTALGAAYLAGIAVGFWKDRSEIANQWNLDKRFEPELEEEKRNE
LYKGWQKAVKAAMAFK
NT seq 1491 nt   +upstreamnt  +downstreamnt
atggaaacgtacattttatccttagatcaggggacgacaagttcaagagcgattctgttt
aataaagaaggcaaaattgtccactctgctcaaaaggaatttacacaatacttcccgcat
cctggctgggttgagcataatgccaatgaaatttggggctctgtcctcgcggttatcgcc
tcagtcatctctgaatcaggaatcagcgcttctcaaattgccggcatcggcatcacgaac
cagcgcgagacgacggttgtgtgggataaagatacaggaagtcctgtctataatgcaatc
gtttggcagtccagacagacgtccggcatttgtgaggaacttcgtgaaaaaggatataat
gataaattcagagaaaaaacagggcttttaatcgatccttacttctccggcacgaaggtg
aagtggattttagacaatgtggaaggcgcaagagaaaaagcggaaaaaggcgagctgctg
tttggaacgattgatacgtggctcatttggaaaatgtcaggcggaaaagcgcatgtgacc
gattactccaatgcctcaagaacactgatgtttaatatttacgatttaaaatgggacgat
gaactgctcgacattctaggcgtaccgaaatccatgctccctgaagtgaagccgtcctct
catgtgtatgcggagactgttgattatcacttcttcggaaaaaatatcccgattgctgga
gcggcaggcgaccagcagtccgcattgttcggccaggcatgctttgaagaaggcatgggg
aaaaacacttacggcacaggatgtttcatgctgatgaataccggggaaaaagcaattaag
tccgaacatgggcttttgacaacaatcgcttggggcattgacggaaaagtgaactatgcg
ttagaagggagcatttttgtcgcaggctctgccatccagtggcttagagacggtttgaga
atgttccaggattcatcgctaagcgaatcttatgcagaaaaagtggattcaactgacggc
gtgtatgttgttccagcatttgtcggactgggaacgccttactgggacagcgatgtgcgc
ggttcggttttcggcctgacaagagggacaacaaaagagcactttatccgtgcgacactg
gagtcattggcttatcagaccaaagatgtgcttgacgcaatggaagcagattcaaacatt
tcattaaagacgctccgtgtagacggaggagctgtaaaaaacaatttcctaatgcagttc
caaggagacctgttgaatgttcctgtggagcgcccggaaattaatgaaacgactgcactt
ggcgcggcttatttggcgggtatcgctgtgggattctggaaggaccgttctgaaatcgcg
aaccagtggaatctggataaacggtttgagcctgaattggaagaagaaaaacgaaatgag
ctgtataaaggctggcaaaaagccgtgaaagcagctatggcttttaaataa

DBGET integrated database retrieval system