KEGG   Bacillus subtilis subsp. subtilis 168: BSU09300Help
Entry
BSU09300          CDS       T00010                                 

Gene name
glpD
Definition
(RefSeq) aerobic glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00564  Glycerophospholipid metabolism
bsu01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    BSU09300 (glpD)
Enzymes [BR:bsu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     BSU09300 (glpD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 GIDA Pyr_redox_2 NAD_binding_8 FAD_oxidored 3HCDH_N
Motif
Other DBs
NCBI-GeneID: 936250
NCBI-ProteinID: NP_388811
Pasteur: BG10188
BSORF: BG10188
UniProt: P18158
Position
1004975..1006642
Genome map
AA seq 555 aa AA seqDB search
MMNHQFSSLERDRMLTDMTKKTYDLFIIGGGITGAGTALDAASRGMKVALSEMQDFAAGT
SSRSTKLVHGGLRYLKQFEVKMVAEVGKERAIVYENGPHVTTPEWMLLPFHKGGTFGSFT
TSIGLRVYDFLAGVKKSERRSMLSAKETLQKEPLVKKDGLKGGGYYVEYRTDDARLTIEV
MKEAVKFGAEPVNYSKVKELLYEKGKAVGVLIEDVLTKKEYKVYAKKIVNATGPWVDQLR
EKDHSKNGKHLQHTKGIHLVFDQSVFPLKQAVYFDTPDGRMVFAIPREGKTYVGTTDTVY
KEALEHPRMTTEDRDYVIKSINYMFPELNITANDIESSWAGLRPLIHEEGKDPSEISRKD
EIWTSDSGLITIAGGKLTGYRKMAEHIVDLVRDRLKEEGEKDFGPCKTKNMPISGGHVGG
SKNLMSFVTAKTKEGIAAGLSEKDAKQLAIRYGSNVDRVFDRVEALKDEAAKRNIPVHIL
AEAEYSIEEEMTATPADFFVRRTGRLFFDINWVRTYKDAVIDFMSERFQWDEQAKNKHTE
NLNKLLHDAVVPLEQ
NT seq 1668 nt NT seq  +upstreamnt  +downstreamnt
atgatgaatcatcaattttcaagtcttgaaagagatcgcatgctgacagacatgacgaaa
aaaacatatgacctatttattatcggaggaggaattacaggagccggaacagctcttgac
gcggcatcaaggggaatgaaggtcgcactaagcgaaatgcaggactttgcggcgggaaca
tcaagccgatcaacgaagctggtacatggcggcttgcgctatttaaaacaatttgaagtg
aaaatggtcgctgaggtaggaaaagagcgggcgattgtgtatgaaaacggcccgcatgtc
actacaccggaatggatgctgcttccgtttcataaaggcggcacattcggttcatttaca
acatctattgggttaagggtttatgacttccttgcaggtgtgaaaaagtcagaacgaaga
agcatgctttcagcaaaagaaacgctgcaaaaagagcctttggtgaaaaaagacggctta
aaaggcggcgggtactatgtggaataccgcactgacgatgcgagactgaccatcgaagtc
atgaaggaagcggttaaattcggggcagagcctgtgaattactccaaagtgaaggagctt
ctttacgaaaaaggcaaagccgtcggcgtattaattgaagatgtgctgacaaagaaagaa
tataaagtgtatgcgaaaaaaattgtcaatgctacaggcccttgggtcgatcagctcaga
gaaaaagaccattcgaaaaacggaaagcatttgcagcatacaaaaggcattcaccttgta
tttgaccagtctgtctttccgctgaaacaggctgtatatttcgatacacctgatggccgg
atggtatttgcgattcctcgtgaaggcaaaacatacgtgggaacaacagacactgtttac
aaagaggcgctggagcatccgcggatgacaacggaggatcgtgattatgtcatcaaatca
atcaattacatgttcccggaactgaatatcactgcgaatgacatcgaatccagctgggcg
gggctgcgtccgctgattcatgaagaaggcaaagatccttctgaaatttcacggaaagac
gagatttggacatctgactcaggcctgatcaccattgccggcggaaaactgactggatac
agaaaaatggcggagcacatcgttgatcttgtccgtgatcgcttaaaagaagagggcgaa
aaggattttggaccatgtaaaacgaaaaacatgccaatctctggcgggcacgtcggcggt
tcgaaaaatcttatgtccttcgttaccgcgaaaacaaaagaaggaattgcagccggttta
tcagaaaaagacgcaaaacagcttgcgatcagatacggctctaacgtagatcgcgtcttt
gaccgggtagaagcgctgaaagatgaggccgcgaaacgcaacattccggttcatattctt
gctgaggcagaatacagtatagaagaagagatgactgcaacccctgctgacttctttgtc
cgcagaacgggacgtttattttttgatatcaattgggtaagaacatataaagatgccgtt
attgattttatgagcgagcgattccaatgggatgagcaggcgaaaaacaaacatacagaa
aacctcaacaagcttttacacgatgcggtcgtaccgcttgagcaataa

DBGET integrated database retrieval system