KEGG   Bacillus subtilis subsp. subtilis 168: BSU09310
Entry
BSU09310          CDS       T00010                                 

Symbol
pgcA
Name
(RefSeq) phosphoglucomutase
  KO
K01835  phosphoglucomutase [EC:5.4.2.2]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00010  Glycolysis / Gluconeogenesis
bsu00030  Pentose phosphate pathway
bsu00052  Galactose metabolism
bsu00230  Purine metabolism
bsu00500  Starch and sucrose metabolism
bsu00520  Amino sugar and nucleotide sugar metabolism
bsu00521  Streptomycin biosynthesis
bsu01100  Metabolic pathways
bsu01110  Biosynthesis of secondary metabolites
bsu01120  Microbial metabolism in diverse environments
bsu01250  Biosynthesis of nucleotide sugars
Module
bsu_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BSU09310 (pgcA)
   00030 Pentose phosphate pathway
    BSU09310 (pgcA)
   00052 Galactose metabolism
    BSU09310 (pgcA)
   00500 Starch and sucrose metabolism
    BSU09310 (pgcA)
   00520 Amino sugar and nucleotide sugar metabolism
    BSU09310 (pgcA)
  09104 Nucleotide metabolism
   00230 Purine metabolism
    BSU09310 (pgcA)
  09110 Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    BSU09310 (pgcA)
Enzymes [BR:bsu01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     BSU09310 (pgcA)
SSDB
Motif
Pfam: PGM_PMM_I PGM_PMM_III PGM_PMM_II PGM_PMM_IV
Other DBs
NCBI-GeneID: 936247
NCBI-ProteinID: NP_388812
Pasteur: BG10189
BSORF: BG10189
UniProt: P18159 A0A6M4JGD0
Position
1006774..1008519
AA seq 581 aa
MTWRKSYERWKQTEHLDLELKERLIELEGDEQALEDCFYKDLEFGTGGMRGEIGAGTNRM
NIYTVRKASAGFAAYISKQGEEAKKRGVVIAYDSRHKSPEFAMEAAKTLATQGIQTYVFD
ELRPTPELSFAVRQLNAYGGIVVTASHNPPEYNGYKVYGDDGGQLPPKEADIVIEQVNAI
ENELTITVDEENKLKEKGLIKIIGEDIDKVYTEKLTSISVHPELSEEVDVKVVFTPLHGT
ANKPVRRGLEALGYKNVTVVKEQELPDSNFSTVTSPNPEEHAAFEYAIKLGEEQNADILI
ATDPDADRLGIAVKNDQGKYTVLTGNQTGALLLHYLLSEKKKQGILPDNGVVLKTIVTSE
IGRAVASSFGLDTIDTLTGFKFIGEKIKEYEASGQYTFQFGYEESYGYLIGDFARDKDAI
QAALLAVEVCAFYKKQGMSLYEALINLFNEYGFYREGLKSLTLKGKQGAEQIEAILASFR
QNPPQKMAGKQVVTAEDYAVSKRTLLTESKEEAIDLPKSNVLKYFLEDGSWFCLRPSGTE
PKVKFYFAVKGSSLEDSEKRLAVLSEDVMKTVDEIVESTAK
NT seq 1746 nt   +upstreamnt  +downstreamnt
atgacttggagaaagagctatgaacgctggaaacagacagaacatttagatctggaatta
aaagagcgccttattgaattagagggagatgaacaggcccttgaggactgtttctataaa
gaccttgaattcggtaccggcggaatgcgcggggaaatcggcgccgggacaaatcggatg
aatatttacactgtgcgcaaagcatcggccgggtttgcggcatacatctcgaagcaaggt
gaggaagcgaaaaaacggggcgttgtcattgcttatgattcccgccataagtctccggag
ttcgcgatggaagcggcaaaaacacttgcgacacaaggcatccaaacatacgtgtttgat
gagcttcgcccgacgccagagctgtcattcgctgttagacagctgaacgcttatggtgga
attgtggtaacggcaagccataacccgcctgaatataacggctacaaagtatacggggat
gatggcggccagctgcctccaaaggaagcggacatcgtcattgagcaggtaaacgcgatt
gaaaatgagctgacgatcacagtggacgaagaaaataagttaaaagaaaaaggcttaatc
aaaatcatcggtgaagatattgataaagtttatacagaaaaactgacgtccatttctgta
catcctgaattatcggaagaagtagatgtaaaggttgttttcacaccgctgcatggaact
gcaaataaaccggtcagacgcggtcttgaagcactcggctacaaaaatgtaacggttgtc
aaagaacaggaactgccggattcaaacttctccactgttacatcgccgaacccggaagag
catgcggcattcgaatatgccattaagcttggggaggagcagaatgcagatattctcatc
gcgacagatcctgatgctgaccgcctcggcatcgcggtgaaaaacgatcaaggcaaatat
acagtgctgacaggaaaccaaaccggagcgttgctgcttcattacctgctttctgaaaag
aaaaaacaaggcatcctgcctgataacggtgttgttctcaaaacgatcgtcacaagcgaa
atcggccgtgctgtagcttcttcattcggccttgatacgattgatacgctgacaggcttt
aagtttatcggtgaaaagattaaggaatacgaagcatcaggccagtataccttccaattc
ggttatgaagagagctacggttatttaatcggggattttgcccgcgataaggacgccatt
caggctgcgcttttggcagttgaagtttgcgcgttctataaaaaacagggaatgtcattg
tatgaggcgctcatcaatctctttaacgaatatggtttttatcgtgaagggctgaaatcc
ctgacgctgaaaggcaaacaaggagcagagcaaattgaagcgattcttgcttccttcaga
caaaatccgccgcagaaaatggcgggcaaacaggttgtcacagcagaagattacgctgta
agcaaacggacgcttctgactgaaagcaaagaagaagccatcgacttgccaaaatcaaat
gtattgaaatacttcctggaagacgggtcttggttctgtctccgtccttctggaactgag
ccgaaggttaaattttatttcgccgtaaaagggtcatctttggaagacagtgaaaagcga
cttgccgtcctttctgaagatgtaatgaagacggtggatgaaattgttgagtcaacagca
aaataa

DBGET integrated database retrieval system