KEGG   Bacillus subtilis subsp. subtilis 168: BSU09320
Entry
BSU09320          CDS       T00010                                 

Symbol
yhcY
Name
(RefSeq) sensor histidine kinase
  KO
K02480  two-component system, NarL family, sensor kinase [EC:2.7.13.3]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:bsu01001]
    BSU09320 (yhcY)
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:bsu02022]
    BSU09320 (yhcY)
Enzymes [BR:bsu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.13  Protein-histidine kinases
    2.7.13.3  histidine kinase
     BSU09320 (yhcY)
Protein kinases [BR:bsu01001]
 Histidine kinases
  NarL family
   BSU09320 (yhcY)
Two-component system [BR:bsu02022]
 NarL family
  Unclassified
   BSU09320 (yhcY)
SSDB
Motif
Pfam: HisKA_3 GAF_2 GAF_3 GAF HATPase_c STN
Other DBs
NCBI-GeneID: 939760
NCBI-ProteinID: NP_388813
Pasteur: BG13005
BSORF: BG13005
UniProt: O07527 A0A6M4JHS3
Position
1008668..1009807
AA seq 379 aa
MSKTRMEKLKTLKTIAETLNQGHDIKATLDEVLKELLSLTNLQSGWIFLIEEDGSYTLAA
DAYLPPALSRKEKVLMCEGECYCLTKFNNGGLRKAANIMNCKRIESAENLHCFDTEGITH
HATVPLEDGDRRFGLLNVAAAGKTMFDEEELHLLESVAFQIGTAIQRMRLSEYQQKNALL
MERNRLAQELHDSVNQMLFSVSLTAKAAKTLTKDENLQQMIDFIQNLSQDALAEMKALIW
QLRPGGLEKGLAEAIKSYGALIGLKIIFTQKGCPVLTDEQEHMLWRVVQEALNNCKKHAG
TDTAYVSLTASLCHAELDIIDHGAGFRYEAHAGLPSLGIKGMKERAEKAGAKFWIESALG
TGTKLSIRLPLKSRKGGAV
NT seq 1140 nt   +upstreamnt  +downstreamnt
gtgagcaaaacgaggatggaaaaattaaaaacgctgaaaacgattgcggaaaccttaaat
caagggcacgatatcaaagcaacactggatgaggttttaaaagagttgctgagtctgaca
aaccttcaatccggatggatttttctgatcgaagaagatgggtcttatacgttagcggcc
gacgcttatctgcccccggctttaagccgcaaggaaaaagtgctgatgtgcgaaggggag
tgttactgcctgacgaaattcaataacggagggcttagaaaagctgcaaatatcatgaac
tgcaaacgcatcgaatcagcagaaaacctgcattgttttgacacagaagggattacgcat
catgcaactgtgcctttagaagacggggacagaagattcggattgttaaatgtagcggcg
gccggaaaaaccatgtttgatgaggaagagctgcatttactcgagtctgtcgcctttcag
atcggaacggcaatccagcgtatgaggctttctgaatatcaacaaaaaaatgctctttta
atggagcgtaaccgcctcgctcaggagcttcacgattcagtcaatcaaatgctgttttcc
gtcagtttaactgccaaagctgcgaagacactaacaaaagatgaaaatttacagcagatg
attgatttcatccaaaacctatcacaggacgcgctcgcagaaatgaaagcgttaatttgg
cagcttcgccccggaggattggaaaaagggctggctgaagccattaaaagctatggtgcg
ctcattggattgaagatcatttttacacaaaaaggctgtcctgttctgactgatgagcag
gagcatatgctatggcgtgtcgtacaggaagctttaaataactgcaaaaagcatgccgga
acggatacggcgtatgttagtctgactgcttctttgtgccatgcggagctggatatcatc
gatcatggggcaggatttcgctatgaagcgcatgccggtctgccttcacttggcataaaa
ggtatgaaagagcgagcggaaaaagccggagctaagttttggattgagtcagcgcttgga
actggaacaaagctgtccatcaggcttccgctaaaaagccgaaaaggaggggcggtatga

DBGET integrated database retrieval system