KEGG   Bacillus subtilis subsp. subtilis 168: BSU09330
Entry
BSU09330          CDS       T00010                                 

Symbol
yhcZ
Name
(RefSeq) transcriptional regulator
  KO
K02479  two-component system, NarL family, response regulator
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:bsu02022]
    BSU09330 (yhcZ)
Two-component system [BR:bsu02022]
 NarL family
  Unclassified
   BSU09330 (yhcZ)
SSDB
Motif
Pfam: Response_reg GerE Sigma70_r4_2 HTH_24 Sigma70_r4 HTH_23 HTH_40 DUF705 Csd3_N CENP-B_N HTH_28
Other DBs
NCBI-GeneID: 939750
NCBI-ProteinID: NP_388814
Pasteur: BG13006
BSORF: BG13006
UniProt: O07528 A0A6M4JEQ1
Position
1009804..1010448
AA seq 214 aa
MKIVIADDHHVVRKGLRFFFATQDDIEVVGEAATGLEALRVIEETKPDLVLMDLSMPEMD
GIQAIKKAIQQFPDTNIIVLTSYSDQEHVIPALQAGAKAYQLKDTEPEELVKTRQVHGGE
YKLSTAIMPHVLTHMKNQHDPEKEKYYQLTRREKDVLTEIANGKSNKEIAAALFISEKTV
KTHVSNLLAKLEVADRTQAALFAVKYNLNGEISK
NT seq 645 nt   +upstreamnt  +downstreamnt
atgaaaattgtcattgctgatgatcatcatgttgtcagaaagggtctgcgttttttcttt
gccacccaggatgatattgaagtcgtcggagaagctgcaactggattagaagccctccgt
gtcatcgaagagacaaagccggatcttgtgctaatggatttgtctatgcccgagatggac
ggcattcaagccattaaaaaagcaatacagcaatttccggatacgaatatcattgtgctg
acgagctactctgatcaggagcacgtcatccccgcgcttcaggcaggcgcgaaggcgtat
caattaaaggatacggagcccgaggaattggtgaaaacacgacaagtgcatggtggcgaa
tacaagctttctacagctattatgccccatgtgctgacacatatgaaaaatcagcacgac
ccggaaaaagaaaaatactatcaattaactagaagggaaaaagacgttctgactgaaata
gcgaacgggaaaagcaataaagaaatcgcagcagccttgtttatttcagaaaaaacagta
aaaacccatgtatcgaatcttttagcaaaacttgaagtggccgatcgcacgcaagcagcg
cttttcgcagtgaaatataacctgaatggagagatctcaaaatga

DBGET integrated database retrieval system