KEGG   Bacillus subtilis subsp. subtilis 168: BSU09350
Entry
BSU09350          CDS       T00010                                 

Symbol
yhdB
Name
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: YhdB
Other DBs
NCBI-GeneID: 939272
NCBI-ProteinID: NP_388816
Pasteur: BG13008
BSORF: BG13008
UniProt: O07530 A0A6M3Z8W3
Position
complement(1010984..1011226)
AA seq 80 aa
MDYADYDKALYYTHRSQWDNLLILMVRTEDDLLSKRIEHFLHAYHFEQDYAVLEKMLYSL
LRYIDHATELTYEDQIALLT
NT seq 243 nt   +upstreamnt  +downstreamnt
atggattatgccgattacgataaagcgctttattacacccatcgttctcaatgggataat
ttattaattttaatggtgcgtacagaggacgatttgttatcaaaacgaattgagcatttt
ctgcatgcgtatcattttgaacaggattacgccgttttagaaaagatgctgtattccctt
ctccgatatattgatcatgccacagagctgacttatgaagatcaaatagcccttctcaca
taa

DBGET integrated database retrieval system