KEGG   Bacillus subtilis subsp. subtilis 168: BSU09360
Entry
BSU09360          CDS       T00010                                 

Gene name
yhdC
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: DUF3889
Other DBs
NCBI-GeneID: 936252
NCBI-ProteinID: NP_388817
Pasteur: BG13009
BSORF: BG13009
UniProt: O07531 A0A6M3Z8W8
Position
1011427..1011750
AA seq 107 aa
MKSLPYTIALLFCGLIIVSMAAKGHSTDTDESVQKWEQLAWSKIQDEYKGASFSDYAYMG
RTEVNDQQTKDVFRVTVRQKDDTFSVRAEVYFHPVTNHMISINVFRL
NT seq 324 nt   +upstreamnt  +downstreamnt
atgaaatccctgccgtataccatcgcacttcttttttgcggattgattatcgtgtcaatg
gctgcaaaaggtcattcaacggacacagacgagtccgttcaaaagtgggaacagcttgcc
tggagcaaaattcaggatgaatataagggcgcttcattttctgattatgcttatatgggg
cgtacagaggtgaatgatcagcagactaaagatgtctttcgggtgacagtcagacagaaa
gatgacactttttctgttcgggccgaagtctattttcatccggtgacaaatcatatgatc
agcatcaacgtctttaggctctaa

DBGET integrated database retrieval system