KEGG   Bacillus subtilis subsp. subtilis 168: BSU09370Help
Entry
BSU09370          CDS       T00010                                 

Gene name
lytF
Definition
(RefSeq) peptidoglycan endopeptidase LytF
  KO
K19223  peptidoglycan DL-endopeptidase LytF [EC:3.4.-.-]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:bsu01002]
    BSU09370 (lytF)
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:bsu01011]
    BSU09370 (lytF)
Enzymes [BR:bsu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.-  Acting on peptide bonds (peptidases)
    3.4.-.-  
     BSU09370 (lytF)
Peptidases [BR:bsu01002]
 Cysteine Peptidases
  Family C40
   BSU09370 (lytF)
Peptidoglycan biosynthesis and degradation proteins [BR:bsu01011]
 Peptidoglycan biosynthesis and degradation
  Endopeptidase
   BSU09370 (lytF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LysM NLPC_P60 Peptidase_C92 Coilin_N
Motif
Other DBs
NCBI-GeneID: 939271
NCBI-ProteinID: NP_388818
Pasteur: BG13010
BSORF: BG13010
UniProt: O07532
Position
complement(1011792..1013258)
Genome map
AA seq 488 aa AA seqDB search
MKKKLAAGLTASAIVGTTLVVTPAEAATIKVKSGDSLWKLAQTYNTSVAALTSANHLSTT
VLSIGQTLTIPGSKSSTSSSTSSSTTKKSGSSVYTVKSGDSLWLIANEFKMTVQELKKLN
GLSSDLIRAGQKLKVSGTVSSSSSSSKKSNSNKSSSSSSKSSSNKSSSSSSSTGTYKVQL
GDSLWKIANKVNMSIAELKVLNNLKSDTIYVNQVLKTKSSGSDTSSKDNSSKSNQTSATT
KYTVKSGDSLWKIANNYNLTVQQIRNINNLKSDVLYVGQVLKLTGKASSGSSSSSSSSSN
ASSGTTTTYTVKSGDSLWVIAQKFNVTAQQIREKNNLKTDVLQVGQKLVISGKASSSSSS
GSSNTTSSTSAKINTMISAAKAQLGVPYRWGGTTPSGFDCSGFIYYVLNKVTSVSRLTAA
GYWNTMKSVSQPAVGDFVFFSTYKAGPSHVGIYLGNGEFINANDSGVVISNMNNSYWKQR
YLGAKRYF
NT seq 1467 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaagaaattagcagcagggctgacagcatctgcgattgtcggcacaactttagta
gtgacaccagctgaagcagcaacgattaaggtcaaaagcggagattctttatggaaactg
gcccaaacctataacacaagtgtggcggccctcacatccgccaatcatctttcgactact
gttctgtcgatcggccagacgcttactattccaggcagcaaatccagcacttcttcatct
acttcaagctcaacaaccaagaagagcggaagttctgtttacacagtgaaaagcggagat
tcactttggctgatcgcaaatgagtttaaaatgacggtgcaggaactgaaaaaattaaac
ggactaagcagcgatttaattcgtgctgggcagaaattaaaggtgtccggtactgtttct
tcaagctctagttccagtaaaaaaagcaactctaataagagttcaagctccagttcaaaa
agcagttctaataagagttcaagttcttcatcttctacgggaacatataaggtgcagctt
ggagattcactttggaaaattgcaaacaaagtcaatatgtccatcgctgaattgaaggtc
ttgaacaacttaaaatcagacaccatttacgtgaatcaggtgttgaaaacaaaatcaagc
ggctctgatacgtcttctaaagacaattcatccaaatcgaaccaaacttcagcaacaact
aaatataccgttaaaagcggtgattcactttggaaaatcgcaaacaactataacctgact
gtacagcaaatccgaaatatcaacaatctgaaatcagatgtgctttacgttggacaagta
ttgaagctgacaggtaaagcatcttcaggctcttcatcatcgtcgtcttcttcgtcaaat
gcaagctccggcacgacgactacatacacggtgaaaagcggtgattccttatgggtgatt
gctcaaaaatttaatgtaacagctcagcagattcgtgagaaaaacaatttaaaaacggat
gtcttgcaggttggccaaaagctggtcatttccggaaaagcttcatcatcgtcttcatcc
ggttcttcaaacaccaccagctcaacgagtgcgaagattaacacaatgatttcggccgct
aaagcgcagcttggggttccgtatcgctggggaggcacgacaccgtccgggtttgactgc
agcggattcatttactatgtactgaacaaagtcacatccgtatctagattaacggcagcg
ggatattggaacacaatgaaatcagttagccagcctgctgtcggagatttcgttttcttt
tcaacatataaagccggcccttcccacgtcggaatttacctaggcaacggggaattcata
aatgccaacgattccggagttgtcatttccaatatgaacaactcttactggaaacagcgc
tatctcggtgcaaaacgatatttctaa

DBGET integrated database retrieval system