KEGG   Bacillus subtilis subsp. subtilis 168: BSU09380
Entry
BSU09380          CDS       T00010                                 

Symbol
nsrR
Name
(RefSeq) Rrf2 family transcriptional regulator
  KO
K13771  Rrf2 family transcriptional regulator, nitric oxide-sensitive transcriptional repressor
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:bsu03000]
    BSU09380 (nsrR)
Transcription factors [BR:bsu03000]
 Prokaryotic type
  Helix-turn-helix
   Rrf2 family
    BSU09380 (nsrR)
SSDB
Motif
Pfam: Rrf2 PuR_N GntR TrmB HTH_27 MarR_2
Other DBs
NCBI-GeneID: 939744
NCBI-ProteinID: NP_388819
Pasteur: BG13011
BSORF: BG13011
UniProt: O07573 A0A6M3ZCA7
Position
complement(1013411..1013851)
AA seq 146 aa
MKLTNYTDYSLRVLIFLAAERPGELSNIKQIAETYSISKNHLMKVIYRLGQLGYVETIRG
RGGGIRLGMDPEDINIGEVVRKTEDDFNIVECFDANKNLCVISPVCGLKHVLNEALLAYL
AVLDKYTLRDLVKNKEDIMKLLKMKE
NT seq 441 nt   +upstreamnt  +downstreamnt
atgaagttaaccaattatacagattattcattaagagtgttgatttttctggctgcagag
cgtcccggagaactttcaaatataaaacagattgccgaaacgtattctatttcaaaaaat
catctcatgaaagtcatatacaggctcggccagctcggctacgtagaaacgatacgcgga
cggggcggcggcatacgattaggcatggaccctgaagacatcaacatcggtgaggttgtc
agaaaaacggaggacgattttaatattgttgaatgttttgatgcgaacaagaatctctgt
gttatttccccggtttgcggcttaaaacatgtgctgaatgaagcgcttttagcctacctc
gcagttttagacaaatacacactgcgcgacctcgtcaaaaacaaagaagatatcatgaag
cttttaaaaatgaaggaatag

DBGET integrated database retrieval system