KEGG   Bacillus subtilis subsp. subtilis 168: BSU09400
Entry
BSU09400          CDS       T00010                                 

Symbol
spoVR
Name
(RefSeq) stage V sporulation protein R
  KO
K06415  stage V sporulation protein R
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99978 Cell growth
    BSU09400 (spoVR)
SSDB
Motif
Pfam: SpoVR
Other DBs
NCBI-GeneID: 939747
NCBI-ProteinID: NP_388821
Pasteur: BG10182
BSORF: BG10182
UniProt: P37875
Position
1015647..1017053
AA seq 468 aa
MNAEEKKGLQRAIEEITEIAKGFGLDFYPMRYEICPAEIIYTFGAYGMPTRFSHWSFGKQ
FHKMKLHYDLGLSKIYELVINSDPCYAFLLDSNSLIQNKLIVAHVLAHCDFFKNNCRFQN
TKRDMVESMAATAERIKHYEQVHGIKEVESFLDAILSIQEHIDPSLVRPKLQWSVDDEEE
EIEEAATPYDDLWSLDEKKPKKQVKKSKKPFPPRPEKDILLFIEEHSRELEPWQRDILTM
MREEMLYFWPQLETKIMNEGWASYWHQRIIRELDLTSDEAIEFAKLNAGVVQPSKTGINP
YYLGLKIFEDIEKRYNNPTEEMKKMGVQPDSGREKMFEVREIESDISFIRNYLTKELVMR
EDLYLFQKQGRDYKIIDKQWKSVRDQLVSMRVNGGFPYLTVNDGDYMKNNELYIKHWYEG
IELDLKYLEKVLPYLFQLWGRSVHIESVLEDKEVMFSYDGKGVHRRYL
NT seq 1407 nt   +upstreamnt  +downstreamnt
ttgaacgcggaggagaagaagggattacagcgggcaattgaggaaattaccgaaattgca
aaaggattcggccttgatttctacccgatgagatatgaaatctgcccggctgaaattatt
tatacatttggcgcgtacgggatgccgacaagattcagccactggagcttcggcaagcag
tttcacaagatgaagctgcactatgatctagggttaagtaagatctatgagctggtcatt
aactcagatccatgctacgcttttttgctggacagcaactcactgatccaaaataaattg
attgtcgcacacgttcttgctcattgcgatttcttcaaaaacaactgccgtttccaaaac
acgaagcgcgatatggtggaaagcatggcggcaacagctgaacggataaaacactatgaa
caggttcacgggataaaagaagtcgaatcttttttagatgcaatcctttcgattcaggag
catatcgatccgtcgttggtccgaccaaagctccaatggagtgtggatgatgaggaagag
gagattgaagaggcagccacgccttacgatgatctatggtctttagatgaaaagaaaccg
aaaaaacaagtgaaaaaatcgaaaaaaccgttcccgccgcggcctgaaaaagatatcctg
ctttttatcgaggagcattcccgggagctggagccatggcagcgtgatatattaacgatg
atgagagaggaaatgctttatttctggcctcagctggaaaccaagattatgaatgagggc
tgggcttcctattggcaccagagaattatacgtgagcttgatttaacctctgatgaagcg
atcgagttcgccaagctgaatgcaggtgtcgttcagccgtccaaaacaggcattaatcct
tattatttagggctgaaaatatttgaagacattgaaaagaggtacaacaacccgacggag
gaaatgaagaaaatgggcgtgcagcctgactccggccgggagaaaatgtttgaggtcagg
gagattgaatccgatatctctttcatccgcaattatttaaccaaagaattagtcatgcgc
gaggatctttatttgtttcaaaaacagggccgagattataaaatcatcgataaacagtgg
aagtcggtgcgcgaccagctcgtaagcatgcgggtaaatggcggttttccatatttgaca
gtaaacgacggcgattatatgaaaaataacgaactctatattaagcattggtatgagggc
atagagttggatttgaaatatttggagaaagtgcttccttatttattccagctttgggga
agaagcgtgcacattgagtctgtgcttgaggataaggaagtcatgttttcgtacgacgga
aaaggtgttcaccgcagatatttataa

DBGET integrated database retrieval system