KEGG   Bacillus subtilis subsp. subtilis 168: BSU09410Help
Entry
BSU09410          CDS       T00010                                 

Gene name
phoA
Definition
(RefSeq) alkaline phosphatase
  KO
K01077  alkaline phosphatase [EC:3.1.3.1]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00730  Thiamine metabolism
bsu00790  Folate biosynthesis
bsu01100  Metabolic pathways
bsu02020  Two-component system
Module
bsu_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    BSU09410 (phoA)
   00790 Folate biosynthesis
    BSU09410 (phoA)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    BSU09410 (phoA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bsu04147]
    BSU09410 (phoA)
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:bsu00537]
    BSU09410 (phoA)
Enzymes [BR:bsu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     BSU09410 (phoA)
Exosome [BR:bsu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BSU09410 (phoA)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:bsu00537]
 Enzymes
  BSU09410 (phoA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alk_phosphatase Metalloenzyme ATP-synt_E
Motif
Other DBs
NCBI-GeneID: 936265
NCBI-ProteinID: NP_388822
Pasteur: BG10183
BSORF: BG10183
UniProt: P19406
Position
complement(1017083..1018468)
Genome map
AA seq 461 aa AA seqDB search
MKKMSLFQNMKSKLLPIAAVSVLTAGIFAGAELQQTEKASAKKQDKAEIRNVIVMIGDGM
GTPYIRAYRSMKNNGDTPNNPKLTEFDRNLTGMMMTHPDDPDYNITDSAAAGTALATGVK
TYNNAIGVDKNGKKVKSVLEEAKQQGKSTGLVATSEINHATPAAYGAHNESRKNMDQIAN
SYMDDKIKGKHKIDVLLGGGKSYFNRKDRNLTKEFKQAGYSYVTTKQALKKNKDQQVLGL
FADGGLAKALDRDSKTPSLKDMTVSAIDRLNQNKKGFFLMVEGSQIDWAAHDNDTVGAMS
EVKDFEQAYKAAIEFAKKDKHTLVIATADHTTGGFTIGANGEKNWHAEPILSAKKTPEFM
AKKISEGKPVKDVLARYANLKVTSEEIKSVEAAAQADKSKGASKAIIKIFNTRSNSGWTS
TDHTGEEVPVYAYGPGKEKFRGLINNTDQANIIFKILKTGK
NT seq 1386 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaatgagtttgtttcaaaatatgaaatcaaaacttctgccaatcgccgctgtt
tctgtccttacagctggaatctttgccggagctgagcttcagcaaacagaaaaggccagc
gccaaaaaacaagacaaagctgagatcagaaatgtcattgtgatgataggcgacggcatg
gggacgccttacataagagcctaccgttccatgaaaaataacggtgacacaccgaataac
ccgaagttaacagaatttgaccggaacctgacaggcatgatgatgacgcatccggatgac
cctgactataatattacagattcagcagcagccggaacagcattagcgacaggcgttaag
acatataacaatgcaattggcgtcgataaaaacggaaaaaaagtgaaatctgtacttgaa
gaggccaaacagcaaggcaagtcaacagggcttgtcgccacgtctgaaattaaccacgcc
actccagccgcatatggcgcccacaatgaatcacggaaaaacatggaccaaatcgccaac
agctatatggatgacaagataaaaggcaaacataaaatagacgtgctgctcggcggcgga
aaatcttattttaaccgcaaggacagaaacttgacaaaggaattcaaacaagccggctac
agctatgtgacaactaaacaagcattgaaaaaaaataaagatcagcaggtgctcgggctt
ttcgcagatggagggcttgctaaagcgctcgaccgtgacagtaaaacaccgtctctcaaa
gacatgacggtttcagcaattgatcgcctgaaccaaaataaaaaaggatttttcttgatg
gtcgaagggagccagattgactgggcggcccatgacaatgatacagtaggagccatgagc
gaggttaaagattttgaacaggcctataaagccgcgattgaatttgcgaaaaaagacaaa
catacacttgtgattgcaactgctgaccatacaaccggcggctttaccattggcgcaaac
ggggaaaagaattggcacgcagaaccgattctctccgctaagaaaacacctgaattcatg
gccaaaaaaatcagtgaaggcaagccggttaaagatgtgctcgcccgctatgccaatctg
aaagtcacatctgaagaaatcaaaagcgttgaagcagctgcacaggctgacaaaagcaaa
ggggcctccaaagccatcatcaagatttttaatacccgctccaacagcggatggacgagt
accgatcataccggcgaagaagtaccggtatacgcgtacggccccggaaaagaaaaattc
cgcggattgattaacaatacggaccaggcaaacatcatatttaagattttaaaaactgga
aaataa

DBGET integrated database retrieval system