KEGG   Bacillus subtilis subsp. subtilis 168: BSU09420
Entry
BSU09420          CDS       T00010                                 

Symbol
lytE
Name
(RefSeq) peptidoglycan endopeptidase LytE
  KO
K19224  peptidoglycan DL-endopeptidase LytE [EC:3.4.-.-]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:bsu01002]
    BSU09420 (lytE)
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:bsu01011]
    BSU09420 (lytE)
Enzymes [BR:bsu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.-  Acting on peptide bonds (peptidases)
    3.4.-.-  
     BSU09420 (lytE)
Peptidases and inhibitors [BR:bsu01002]
 Cysteine peptidases
  Family C40
   BSU09420 (lytE)
Peptidoglycan biosynthesis and degradation proteins [BR:bsu01011]
 Peptidoglycan biosynthesis and degradation
  Endopeptidase
   BSU09420 (lytE)
SSDB
Motif
Pfam: LysM NLPC_P60 LRAT
Other DBs
NCBI-GeneID: 939269
NCBI-ProteinID: NP_388823
Pasteur: BG11406
BSORF: BG11406
UniProt: P54421 A0A6M4JGE0
Position
1018998..1020002
AA seq 334 aa
MKKQIITATTAVVLGSTLFAGAASAQSIKVKKGDTLWDLSRKYDTTISKIKSENHLRSDI
IYVGQTLSINGKSTSSKSSSSSSSSSTYKVKSGDSLWKISKKYGMTINELKKLNGLKSDL
LRVGQVLKLKGSTSSSSSSSSKVSSSSTSTYKVKSGDSLSKIASKYGTTVSKLKSLNGLK
SDVIYVNQVLKVKGTSTSSSKPASSSSSSSSKTSSTSLNVSKLVSDAKALVGTPYKWGGT
TTSGFDCSGFIWYVLNKQTSVGRTSTAGYWSSMKSIASPSVGDFVFFTTYKSGPSHMGIY
IGNNSFIHAGSDGVQISSLNNSYWKPRYLGAKRF
NT seq 1005 nt   +upstreamnt  +downstreamnt
atgaaaaagcaaatcattacagctacgacagcagttgttttaggatcgacgttatttgca
ggagcggcatctgcacaaagcattaaggtgaaaaaaggcgacacgttatgggatctttca
agaaaatacgacacaacgatcagtaaaattaaatcagagaaccaccttcgttcagacatt
atttatgtgggacaaactttatcgattaacggcaaatctacaagttcaaaaagcagcagt
tcttcttcctcttcttctacatacaaagtaaagagcggggacagcctttggaaaatttca
aaaaaatacggcatgacaatcaatgaactgaagaagctgaatggcttaaaatcagatttg
cttcgtgttggacaagtcctgaaactgaaaggttcaactagttcaagcagctccagctca
tcaaaagtgtcatcgtcttcaacttctacttataaagtgaagagcggagacagcctttct
aaaattgcgagcaaatacggcactacggttagcaaattaaaaagcttaaacggcttaaaa
tcagatgtaatctatgtcaaccaagtattgaaggtgaaaggaacaagcacaagcagctca
aaacctgcttcatcttcatcgtcttcaagcagcaaaacgtcatctacatcacttaatgtg
agcaagctggtttctgatgcaaaagcgttagtcggaacgccatataaatggggcggaacg
acaacttcaggctttgactgcagcggattcatttggtacgtactgaataaacaaacaagt
gtgggcagaacaagcactgcaggatactggagttctatgaagagcattgccagcccgtct
gttggtgatttcgtcttcttcacaacatataaatccggcccttctcacatggggatttac
attggaaacaacagtttcattcatgcaggatctgacggcgtacaaatcagcagcctgaac
aacagctactggaagcctcgttacctcggtgcgaaaagattctaa

DBGET integrated database retrieval system