KEGG   Bacillus subtilis subsp. subtilis 168: BSU09430
Entry
BSU09430          CDS       T00010                                 

Symbol
citR
Name
(RefSeq) LysR family transcriptional regulator
  KO
K19242  LysR family transcriptional regulator, repressor for citA
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:bsu03000]
    BSU09430 (citR)
Transcription factors [BR:bsu03000]
 Prokaryotic type
  Helix-turn-helix
   LysR family
    BSU09430 (citR)
SSDB
Motif
Pfam: LysR_substrate HTH_1 HTH_24 Mga HTH_30 MarR
Other DBs
NCBI-GeneID: 939267
NCBI-ProteinID: NP_388824
Pasteur: BG10853
BSORF: BG10853
UniProt: P39127 A0A6M4JHT6
Position
complement(1020073..1020948)
AA seq 291 aa
MDFKWLHTFVTAAKYENFRKTAETLFLSQPTVTVHIKQLEKEISCKLFERKGRQIQLTDE
GRAYLPYALRLLDDYENSMAELHRVRQGYSQTLQLAVSPLIADTVLPSVMKRYTAMNTET
EMAVTIFESAEIASLIKAGEADIGLSCLKVQSSSLSCHCLYKDPVVLVAPPDKRFIEDNE
IDAKEVLEQYLLLTHNHPDYWDDLLRQVRMTFPFVRTMKVTQTHITKRFIKEGLGVSFLP
LSTVKRELAEKQMIRIPYQSVQLPYAGAYAIALYENKKEKKFLDFLSHFHF
NT seq 876 nt   +upstreamnt  +downstreamnt
atggatttcaaatggcttcacacctttgtgaccgctgcaaaatatgagaacttccgaaaa
acggcggaaacgcttttcttatctcagcctactgtgaccgtacatatcaagcaattagaa
aaagaaatcagctgcaagctgttcgagcgtaaaggcaggcaaatccagctgactgatgaa
ggcagggcgtatttgccgtatgcgctcaggcttcttgatgattatgaaaacagcatggca
gagcttcacagagtgagacaaggctactctcaaaccttacagctcgcggtttctccgctt
attgcagatacagtgcttccttctgtcatgaagcggtacacagcaatgaatacggaaaca
gaaatggcggttacgattttcgaatcagcggaaatcgcgtcactgattaaagccggggaa
gcagatatcggactaagctgtttaaaggtacagtcttcttctttaagctgccactgctta
tacaaagaccctgtcgtccttgttgccccgcccgataagcgtttcatagaagacaacgaa
attgatgccaaagaggtgctcgaacaatacctgcttttgacccacaatcatcctgattac
tgggacgacttgctccgtcaagtcagaatgacatttccatttgtgagaacaatgaaggtc
actcaaacacatataacgaaacggtttatcaaggaaggactcggagtttcatttctgcct
ttatctacagtaaagcgtgagttagcagagaaacagatgatcagaattccttatcagtct
gtacagctgccctatgccggcgcttacgcgattgccctttatgaaaataagaaagaaaaa
aagttcttggattttttatcacattttcatttttag

DBGET integrated database retrieval system