KEGG   Bacillus subtilis subsp. subtilis 168: BSU09440
Entry
BSU09440          CDS       T00010                                 

Symbol
citA
Name
(RefSeq) citrate synthase
  KO
K01647  citrate synthase [EC:2.3.3.1]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00020  Citrate cycle (TCA cycle)
bsu00630  Glyoxylate and dicarboxylate metabolism
bsu01100  Metabolic pathways
bsu01110  Biosynthesis of secondary metabolites
bsu01120  Microbial metabolism in diverse environments
bsu01200  Carbon metabolism
bsu01210  2-Oxocarboxylic acid metabolism
bsu01230  Biosynthesis of amino acids
Module
bsu_M00009  Citrate cycle (TCA cycle, Krebs cycle)
bsu_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BSU09440 (citA)
   00630 Glyoxylate and dicarboxylate metabolism
    BSU09440 (citA)
Enzymes [BR:bsu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.1  citrate (Si)-synthase
     BSU09440 (citA)
SSDB
Motif
Pfam: Citrate_synt DUF2379
Other DBs
NCBI-GeneID: 936270
NCBI-ProteinID: NP_388825
Pasteur: BG10854
BSORF: BG10854
UniProt: P39119 A0A6M4JEQ9
Structure
PDB: 
2C6X

Position
1021057..1022157
AA seq 366 aa
MVHYGLKGITCVETSISHIDGEKGRLIYRGHHAKDIALNHSFEEAAYLILFGKLPSTEEL
QVFKDKLAAERNLPEHIERLIQSLPNNMDDMSVLRTVVSALGENTYTFHPKTEEAIRLIA
ITPSIIAYRKRWTRGEQAIAPSSQYGHVENYYYMLTGEQPSEAKKKALETYMILATEHGM
NASTFSARVTLSTESDLVSAVTAALGTMKGPLHGGAPSAVTKMLEDIGEKEHAEAYLKEK
LEKGERLMGFGHRVYKTKDPRAEALRQKAEEVAGNDRDLDLALHVEAEAIRLLEIYKPGR
KLYTNVEFYAAAVMRAIDFDDELFTPTFSASRMVGWCAHVLEQAENNMIFRPSAQYTGAI
PEEVLS
NT seq 1101 nt   +upstreamnt  +downstreamnt
atggtacattacggattaaagggaattacatgtgtagaaacatccatcagccatattgat
ggtgaaaaagggcgtctgatttacagaggacatcatgcaaaagacatcgcactgaatcac
agctttgaagaagcggcttatttgattttatttggaaaactgccttcaactgaagaattg
caggtatttaaagataagctggctgcggaacggaatcttccggaacatattgagcgcttg
attcaatcactgccaaacaacatggacgatatgtcggtgctgagaacggttgtttcagca
ttgggggaaaatacgtacacattccatccgaaaacagaggaagcaatccggctgattgca
atcacgccttctatcattgcatacagaaaaagatggacgcgcggtgaacaagcaattgca
ccttcttcccagtacggacatgtcgaaaactactattatatgctcacaggtgaacagcct
tcagaggcaaaaaagaaagcgcttgaaacctatatgattctggccacggagcacggcatg
aacgcatcgactttttcggcacgagtcacgttatctacagagagtgatttagtgtcagcc
gtcacggctgctctcggtacgatgaaaggtccgctgcacggaggtgctccttctgcggtg
acaaaaatgcttgaagacattggagaaaaggaacatgctgaagcatatctgaaagaaaaa
ctcgaaaaaggagagcgcttgatgggattcggccacagggtgtacaaaacaaaagacccg
cgggcagaagctttgagacagaaagcagaagaggtggccggcaatgaccgtgatcttgat
cttgcgctgcatgtagaagcagaagcgattcgtttgctagaaatctacaaaccgggacga
aagctgtacacaaatgttgaattttacgcagctgcagtgatgagggccatcgattttgac
gatgaattgtttactccgaccttttcagcaagccgaatggtagggtggtgcgcccatgta
ctggaacaggcagaaaacaacatgattttccgcccgtcagcgcaatataccggtgccatt
cccgaggaagttctttcataa

DBGET integrated database retrieval system