KEGG   Bacillus subtilis subsp. subtilis 168: BSU09450
Entry
BSU09450          CDS       T00010                                 

Symbol
yhdF
Name
(RefSeq) oxidoreductase
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: adh_short_C2 adh_short KR Epimerase DUF1776
Other DBs
NCBI-GeneID: 939749
NCBI-ProteinID: NP_388826
Pasteur: BG13012
BSORF: BG13012
UniProt: O07575 A0A6M4JLH6
Position
1022231..1023100
AA seq 289 aa
MNPMDRQTEGQEPQHQDRQPGIESKMNPLPLSEDEDYRGSGKLKGKVAIITGGDSGIGRA
AAIAFAKEGADISILYLDEHSDAEETRKRIEKENVRCLLIPGDVGDENHCEQAVQQTVDH
FGKLDILVNNAAEQHPQDSILNISTEQLEKTFRTNIFSMFHMTKKALPHLQEGCAIINTT
SITAYEGDTALIDYSSTKGAIVSFTRSMAKSLADKGIRVNAVAPGPIWTPLIPATFPEEK
VKQHGLDTPMGRPGQPVEHAGAYVLLASDESSYMTGQTIHVNGGRFIST
NT seq 870 nt   +upstreamnt  +downstreamnt
gtgaacccaatggacagacaaacagaaggacaagaaccgcagcatcaggacagacagccg
ggcattgagtcaaaaatgaatccgctgccgctgtcagaggacgaggattatcgaggaagc
ggaaaactgaaaggaaaagttgcgatcattactggaggcgacagcggaatagggagagca
gcagctattgcctttgctaaagagggggctgatatctccattctatacttagacgagcat
tcggacgcagaggaaacacgcaaacggatcgaaaaggagaatgtccgctgcctgcttatc
ccgggagatgttggggacgagaaccattgtgaacaagctgtgcagcaaacagtggaccat
tttggtaaactcgatatcttagtgaacaacgccgctgaacagcatccccaggacagcatt
ctcaatatttcaacagaacagctggaaaaaacctttcgcacaaatattttttccatgttt
catatgacgaagaaagctttgcctcacctgcaagaggggtgtgccattattaatacgaca
tcgattaccgcttatgaaggggatacggcgttaattgattattccagcacaaagggtgcg
attgtttcctttacgcgttccatggcgaagtcgcttgcagataaaggcatcagagtgaat
gcggtggcgcccggtccgatttggacaccgcttattccggcgacattccctgaggaaaaa
gtgaaacagcacggcttggataccccaatgggaagaccgggacagccggttgagcatgca
ggcgcctatgttctgctggcgtctgacgaatcttcctatatgacagggcagaccattcat
gtgaatggcggccgttttatttcaacgtaa

DBGET integrated database retrieval system