KEGG   Bacillus subtilis subsp. subtilis 168: BSU09460
Entry
BSU09460          CDS       T00010                                 

Symbol
ctrA
Name
(RefSeq) amino acid permease
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: AA_permease_2 AA_permease AA_permease_C Spore_permease DUF6713
Other DBs
NCBI-GeneID: 939746
NCBI-ProteinID: NP_388827
Pasteur: BG13013
BSORF: BG13013
UniProt: O07576 A0A6M3Z8W7
Position
1023350..1024747
AA seq 465 aa
MKGSVFRKKSIQDLIAATSGEKSLKRELGAFDLTLLGIGAIIGTGIFVLTGTGAVTAGPG
LTISFVVAALACLFAALSYAEFASSVPVSGSVYTFTYATLGELMAFIIGWDLILEYMLAV
SAVSVGWSGYFQSFLSGLGIHLPVALTAAPGAVKGTFTLFNLPAFVIVMAITYLLYLGIK
ESKRVNNIMVILKILVVLLFIAVAAVYVKPHNWQPFMPMGFGGVFSAAALVFFAFIGFDA
VSSAAEETKNPAKDLPKGIIFSLLVCTILYVTVSAIMTGVIPFAQFAGVDHPVSLVLQSA
GQNWVAGIIDIGAVLGMTTVMLVMLYGQTRVMFAMSRDGLVPGSLSKVHPKHKTPYVATW
FFGTMSALLGSLVPLDELAKLVNIGTLSAFVLISVAVIVLRKKQPDLPRAFKCPGVPVIP
GLAILFCLFLILNLGWVTIVRFLVWLLIGLVIYFLYSRKHSKLNQ
NT seq 1398 nt   +upstreamnt  +downstreamnt
atgaaagggagcgtttttaggaagaaaagcattcaggatttaatcgctgcgacgagcggg
gaaaagtctttaaaaagagaattaggggcatttgatttaacgttgcttggaatcggcgcc
attattggcacagggatttttgttctgacgggaacaggcgcagtcacggccggtcccggg
ctgacgatttcatttgttgtggcggcgttggcttgtttattcgccgccctgtcttacgcg
gaatttgcgtcaagtgtgcctgtttcaggttcggtgtatacattcacttatgcgacattg
ggagagcttatggcctttattatcgggtgggatttaattttagaatacatgctggcggta
agtgcagtgtcggtcggctggtctggttatttccaatcgtttttatcagggcttggcatt
catcttccggttgctttaacagcggcaccgggcgcagtgaaaggcacctttaccctgttt
aatcttcctgcattcgtcattgtaatggcgatcacatatttgctttatttaggcatcaaa
gaatcaaaaagagtcaacaatatcatggttatcttgaagatactggttgttctgctgttt
atcgcggtggcagccgtttacgtgaagccgcacaactggcagccgtttatgccaatgggc
tttggcggcgtgttcagtgcagcggcgctcgtattctttgcttttatcggatttgacgct
gtatcctctgctgcggaagaaacgaaaaatcccgcgaaggatctgcctaaaggcattatt
ttctctttactggtctgcacgattttatatgtcaccgtatcagccatcatgactggggtt
atcccgtttgctcaatttgcgggtgtggatcatccggtttctcttgttcttcaaagcgca
gggcaaaattgggtggcaggcatcattgatattggcgccgtgttgggaatgacaacagtt
atgctcgtgatgctttacgggcagacccgcgtcatgtttgccatgtcgcgtgacggactt
gtgccgggttcactttctaaagtgcatccaaagcacaaaacaccttatgtagccacttgg
tttttcggaacgatgtcggcgcttctcggctcacttgttccgctggatgaacttgcaaag
ctggtgaacatcgggacgttgtcggcatttgtcctgatttctgtggcagttatcgttttg
agaaagaaacagcctgatcttccgagagcttttaaatgcccgggagttcccgtgatccca
ggcctggcgattctgttctgcctgttcttgattttaaatctgggatgggtgacgattgtc
cgcttcctagtgtggctgttaatcggcttggtaatctatttcctgtattcaagaaagcat
tcaaaattaaatcaataa

DBGET integrated database retrieval system