KEGG   Bacillus subtilis subsp. subtilis 168: BSU09470
Entry
BSU09470          CDS       T00010                                 

Symbol
yhdH
Name
(RefSeq) sodium-dependent transporter YhdH
  KO
K03308  neurotransmitter:Na+ symporter, NSS family
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    BSU09470 (yhdH)
SSDB
Motif
Pfam: SNF BCCT
Other DBs
NCBI-GeneID: 936264
NCBI-ProteinID: NP_388828
Pasteur: BG13014
BSORF: BG13014
UniProt: O07577 A0A6M3Z8X4
Position
1024865..1026220
AA seq 451 aa
MSEQKPVQWASKIGFVMAAAGSAIGLGAIWKFPYVAGTNGGGAFFLIFVLFTILLGYPLL
VGEFIFGRRNQTNAIDAYKKEAPRSAWFLTGWIGVAACFLVLSFYSVIGGWILLYIVKTA
SGSLSGLSQAQYGALFASIIQNPVQTLAAQLVFMALTVLVVARGVQKGIERVSAVMMPIL
FLLFILLVLRSLTLNGAMEGVKFLLVPHFGDLTPESILFALGQAFFTLTLGVSVMVTYSS
YLPKTQNIPRSAASIVLMNIIVTLLAGLAIFPAVFSFGFQPNEGPTLLFTVLPAVFEQLP
FGTLFFIGFLVAFLFAALTSAFSMVEIIVATIGKGDEKKRKKLSWTSGLLIFLVGIPCCL
SYGVLSDVHLFGKTFFDIADFTVSNVLMPSGALLISLFIPLKISKSELLAEMRNGSNAGK
AFFYTWFYLLRFIVPLAIIIVFLNLIGILSF
NT seq 1356 nt   +upstreamnt  +downstreamnt
ttgtctgagcaaaaaccagtccaatgggcttcgaaaattggtttcgtcatggcagcggcc
ggctcggctatcggcttgggcgcgatttggaagttcccttacgtagcggggaccaatggg
ggaggagccttttttcttatcttcgtgttatttaccatcctcttaggctatccgcttttg
gtgggggaatttatttttggaagacggaaccagacgaatgccattgatgcatataaaaaa
gaagcgccgcgatcagcttggtttcttacggggtggatcggcgtagcggcgtgtttctta
gtgctgtcgttttacagtgtaatcgggggatggattttgctgtatatcgtgaaaacagcg
tcaggatcactgtccgggctttctcaagcacagtatggcgctctttttgcttctattatc
caaaatccggtgcagacgctcgcggctcagcttgtctttatggcactgactgtactcgtt
gtcgcaagaggggttcaaaaagggattgaacgggtaagcgcggtgatgatgccgattttg
tttttattgtttattctgctcgttcttcggtctcttacgcttaatggtgcaatggaaggc
gtaaagtttctgcttgtgcctcatttcggcgatctgactccggaatccatattattcgcg
ctgggacaggccttctttacgttaacactgggggtttcggtgatggtgacctacagctcc
tatttgccgaaaacacaaaatatccctcgttcggcagcctccattgtcttgatgaatatc
attgtgacactcttggcaggtttggctatttttccggcggttttctcattcggttttcag
ccaaatgaaggaccgacattgctgtttacagtgcttccggccgtttttgaacagcttccg
ttcggcacattgttttttatcggctttctcgttgcatttttatttgcagccttaacctca
gcattttcgatggttgaaattatcgttgccacaatcggaaaaggggacgaaaagaagaga
aaaaaactgtcatggacgagcgggcttttgatctttttggtcggaatcccatgctgcttg
tcttatggcgttttgagtgatgtgcacctatttggcaaaacgttttttgatattgccgat
tttaccgtcagcaatgttttgatgccttcaggcgctctgttaatttctctatttatcccg
ctgaaaatttcgaaaagcgaactcttggctgaaatgcgaaatggatcaaatgcaggtaaa
gcattcttttacacatggttttatttgcttcgttttatcgtgccgcttgccattattatc
gtgttcttaaatttaatcggaattttatcattttaa

DBGET integrated database retrieval system