KEGG   Bacillus subtilis subsp. subtilis 168: BSU09480
Entry
BSU09480          CDS       T00010                                 

Symbol
yhdI
Name
(RefSeq) GntR family transcriptional regulator
  KO
K00375  GntR family transcriptional regulator / MocR family aminotransferase
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:bsu03000]
    BSU09480 (yhdI)
Transcription factors [BR:bsu03000]
 Prokaryotic type
  Helix-turn-helix
   GntR family
    BSU09480 (yhdI)
SSDB
Motif
Pfam: Aminotran_1_2 GntR Fe_dep_repress HTH_11
Other DBs
NCBI-GeneID: 939277
NCBI-ProteinID: NP_388829
Pasteur: BG13015
BSORF: BG13015
UniProt: O07578 A0A6M4JEI1
Position
complement(1026255..1027664)
AA seq 469 aa
MDITPFLDKKSKTPLYEQLYTFFKQEISHARITKGTRLPSKRRLSSLLDVSTATIERAYE
QLTAEGYVKSKPKIGWFAAEVEPGFPTAPDHFQQSVQPGLHQKNAPAIDFHQGSVDPTLF
PFNAWRKSIVKSLDRYSGSFHTSGDPQGEYELRHMIARFVRLSRGVNCEPGQIIIGAGTT
VLLQNLCLSLKPGTKIGFEEPGFHRSRRMFEANHMDVTPICSDAEGVLPDELYRQNPYLM
YTTPSHQFPIGTIMTITRRQELLAWAAETNSFIIEDDYDGEFRYSGHPIPSLQGLDPNGR
VIYLGTFSKSLLPSLRLSFMIVPPELMEPIQNNVQLMKQTVSAHSQLALADFIETGEWQK
HINRMRSLYRKKHAVLLEAIRSELGNTVEILGKNSGLHILLRLLFPASEEEAIQAAADHG
VTLYPVSPSYIEQTPFTSVLIGYGGLSEEDIRLGIQKLKTAWAPLISSY
NT seq 1410 nt   +upstreamnt  +downstreamnt
atggatattacgccgtttcttgataaaaagagcaaaacaccgctgtatgaacagctttat
accttttttaaacaagaaatttcacatgcgcgaatcacaaagggaacaagacttccgtca
aaacgcaggctctccagcttgctcgatgtcagcacggcaactatagaacgagcttatgag
caattaactgctgagggctatgtcaaaagcaagccgaaaatcggctggttcgcggcggaa
gtagaaccaggattcccgacagctcctgaccattttcagcagtctgtacagccgggatta
catcaaaaaaacgcacctgctattgacttccatcagggcagcgttgatccgaccctcttt
ccctttaacgcatggagaaaaagcatagtaaaaagtcttgatcgctattccggatcgttt
cacacctctggcgaccctcaaggagaatacgaactcaggcacatgattgcccgattcgtc
aggctgtctcggggagtaaattgtgaacccggccagattatcatcggcgcaggaaccacc
gtgcttctgcaaaatctttgcctttcgctaaagccaggtacaaaaatcggctttgaagaa
ccgggctttcaccgttcaagaaggatgtttgaagcaaatcacatggatgtcactccgatt
tgttctgatgcagaaggcgtcctgccggatgagctctaccgtcagaatccttatctcatg
tatacgactccttcgcatcagtttccgattgggaccattatgacgattacccgcagacag
gagctgctggcatgggcggcagaaacaaattcattcattatagaagatgattacgatgga
gaatttcgctacagcggccatcccattccgtctttacagggtcttgatccgaatggcaga
gtcatatatctgggcactttttcaaagtcacttctgccttccttgcggctcagcttcatg
attgtgccccctgaactcatggaaccgatccaaaacaatgttcagttaatgaagcagacc
gtttctgcccactcgcaattggcactggcagacttcatcgaaaccggagagtggcaaaaa
cacataaatagaatgagaagcttataccgaaaaaaacacgctgtcctgttagaagccatt
cgctctgaactgggaaacaccgttgagattctcggtaagaactcggggcttcacattctg
ctgcgccttttgtttccagcaagtgaggaagaagcaatacaagcagccgctgaccacggt
gtaaccctctatcccgtgtctccctcatatatagaacagacgccttttacttctgtctta
atcggttatggcggtttgtcagaagaggacatcaggctcggcatccaaaaactgaaaacg
gcatgggcaccgttgatatcatcttattaa

DBGET integrated database retrieval system