KEGG   Bacillus subtilis subsp. subtilis 168: BSU09490
Entry
BSU09490          CDS       T00010                                 

Symbol
yhdJ
Name
(RefSeq) N-acetyltransferase YhdJ
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: Acetyltransf_1 Acetyltransf_7 Acetyltransf_10 Acetyltransf_4
Other DBs
NCBI-GeneID: 939275
NCBI-ProteinID: NP_388830
Pasteur: BG13016
BSORF: BG13016
UniProt: O07579 A0A6M3Z8X7
Position
1027774..1028202
AA seq 142 aa
MIHMKQLTSKEEWAESYPIMSELRTELDIETYLQRLEACVQKESYMLFALYENTAIRALC
GALPRVSIHKGEHLWIADLVTTAPCRSKGYGKMLLDYASDWARKAGLGFVSLSSGLQRKD
AHRFYTDKMGFTIESYLFRKPV
NT seq 429 nt   +upstreamnt  +downstreamnt
atgatccatatgaaacaattaacctcgaaagaagaatgggctgagtcgtatccgattatg
agtgaattgagaacagaactggatatagagacgtatttacaaaggcttgaagcctgtgtg
cagaaagaatcgtatatgctgtttgccttatatgaaaatacagcaatcagagcgctgtgc
ggggctctgccgagagtttccattcataaaggagagcacttgtggattgcggatcttgtt
acaacggcaccttgccgatcaaagggatacggcaaaatgcttttggattatgcctcagac
tgggcgagaaaagccggactcggttttgtcagtctttcatctggccttcagcgtaaagac
gcacatcgattttatacagataaaatgggttttactatagaaagttatttgttccgaaaa
ccggtataa

DBGET integrated database retrieval system