KEGG   Bacillus subtilis subsp. subtilis 168: BSU09500
Entry
BSU09500          CDS       T00010                                 

Symbol
yhdK
Name
(RefSeq) anti-sigma-M factor YhdK
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: Sigma_M_inh
Other DBs
NCBI-GeneID: 936268
NCBI-ProteinID: NP_388831
Pasteur: BG13017
BSORF: BG13017
UniProt: O07580 A0A6M3ZCB9
Position
complement(1028233..1028523)
AA seq 96 aa
MELVRIFKEHNVFGWISVGTAVLSLLLLNLAIISNVTFYSYQMLPFAMAAVPFGVVELFI
KRGRTGPGLLGVILNLFVIICVYTIVSVDTNLQFGF
NT seq 291 nt   +upstreamnt  +downstreamnt
atggaactggtaagaatttttaaagaacacaatgtattcggctggatctctgtcgggaca
gcggttctgtccctgctgttgctgaatttggccattatcagcaacgtcacgttttattcc
tatcaaatgcttccgttcgccatggctgccgttccgttcggcgttgttgaactcttcatc
aagagagggcgcacaggtccaggcctgctcggcgtcatccttaatctctttgtgattatt
tgtgtgtataccattgtatctgtagatacgaatttacagtttggcttttaa

DBGET integrated database retrieval system