KEGG   Bacillus subtilis subsp. subtilis 168: BSU09510Help
Entry
BSU09510          CDS       T00010                                 

Gene name
yhdL
Definition
(RefSeq) anti-sigma-M factor YhdL
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sigma_reg_C Sigma_reg_N Herpes_UL20 TMEM191C
Motif
Other DBs
NCBI-GeneID: 939753
NCBI-ProteinID: NP_388832
Pasteur: BG13018
BSORF: BG13018
UniProt: O07581
Position
complement(1028511..1029587)
Genome map
AA seq 358 aa AA seqDB search
MMNEEFKKRFDQYKNGEMSDQEMTAFEEELEKLEVYQELIDSELEDDNDWDLSISPEKQK
AILAYGKRKSYLRISVLAVISTLMILPLCTLGSYLYYGMGGKHSTGNEFMETAAVTVALT
MPNVLVDTSGLKSQVKLFGMNTEFPLQKQIGTKTAAVGNERVEMFYNKVKAPAVNYYDLE
VNKTGHYFTHPSNKSEQTTAKAEKTLSTLPEGTVSEVYLSYDRAYPTKDVYNKFKGYDVS
FLWNAIETEKNTNKTASTEPLGYPGKDSKFLAALNTKGKSNGDQFINALKFMSKHEKWAQ
VISKRKDLNVDNRLDYVEKNGVNVYGSVVTGPTKEIQRMLKNKSVKSANVGEVELWNW
NT seq 1077 nt NT seq  +upstreamnt  +downstreamnt
atgatgaatgaagaatttaaaaagcgttttgatcaatataaaaatggggaaatgagcgac
caggaaatgactgcatttgaggaagaactcgagaagcttgaagtatatcaggaactgatt
gacagcgaactagaggacgataacgattgggatctcagcatcagtcctgaaaaacaaaaa
gcgattttagcctacggcaaacgcaagtcttatttgcgaatttctgtgcttgccgtcatt
tcgacattgatgattttgccgctttgtacgctgggaagctacctctattacggaatgggt
ggaaaacacagcaccggcaatgagtttatggaaactgccgcagtcactgtagccctgacc
atgccgaatgttcttgttgatacttccggactgaaaagccaagtgaagctatttggaatg
aatacggaattcccgctgcaaaagcagattggcacgaagacggctgccgtagggaatgaa
cgggttgaaatgttttataacaaagtaaaagcgccggcagtaaactactatgacttagaa
gtgaataaaaccggccattactttacacatccttcaaacaagtctgaacaaacgaccgca
aaagcagaaaaaacgttaagcacattgcctgaaggaacggtatcagaggtctacctttca
tatgaccgtgcatatccgacaaaagacgtgtataacaaattcaaaggctatgatgtgagc
tttttgtggaacgcaatcgaaacagagaaaaacacaaataagacagcttccacagaacct
cttggctatcctggaaaggattcaaagttcttggccgcccttaatacaaaaggcaagtcg
aatggcgatcagtttatcaacgccctgaaattcatgtccaaacacgaaaaatgggctcag
gtcatttcaaaacggaaagacctgaatgtagataaccgattagattatgtagagaaaaac
ggtgtcaatgtatacggttcggtcgttacagggccaaccaaggaaatccagcgcatgctg
aaaaataaatctgtaaaatcagcgaatgtcggcgaggtggaattatggaactggtaa

DBGET integrated database retrieval system