KEGG   Bacillus subtilis subsp. subtilis 168: BSU09510
Entry
BSU09510          CDS       T00010                                 

Symbol
yhdL
Name
(RefSeq) anti-sigma-M factor YhdL
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: Sigma_reg_C Sigma_reg_N TMEM191C Herpes_UL20
Other DBs
NCBI-GeneID: 939753
NCBI-ProteinID: NP_388832
Pasteur: BG13018
BSORF: BG13018
UniProt: O07581 A0A6M4JGU9
Position
complement(1028511..1029587)
AA seq 358 aa
MMNEEFKKRFDQYKNGEMSDQEMTAFEEELEKLEVYQELIDSELEDDNDWDLSISPEKQK
AILAYGKRKSYLRISVLAVISTLMILPLCTLGSYLYYGMGGKHSTGNEFMETAAVTVALT
MPNVLVDTSGLKSQVKLFGMNTEFPLQKQIGTKTAAVGNERVEMFYNKVKAPAVNYYDLE
VNKTGHYFTHPSNKSEQTTAKAEKTLSTLPEGTVSEVYLSYDRAYPTKDVYNKFKGYDVS
FLWNAIETEKNTNKTASTEPLGYPGKDSKFLAALNTKGKSNGDQFINALKFMSKHEKWAQ
VISKRKDLNVDNRLDYVEKNGVNVYGSVVTGPTKEIQRMLKNKSVKSANVGEVELWNW
NT seq 1077 nt   +upstreamnt  +downstreamnt
atgatgaatgaagaatttaaaaagcgttttgatcaatataaaaatggggaaatgagcgac
caggaaatgactgcatttgaggaagaactcgagaagcttgaagtatatcaggaactgatt
gacagcgaactagaggacgataacgattgggatctcagcatcagtcctgaaaaacaaaaa
gcgattttagcctacggcaaacgcaagtcttatttgcgaatttctgtgcttgccgtcatt
tcgacattgatgattttgccgctttgtacgctgggaagctacctctattacggaatgggt
ggaaaacacagcaccggcaatgagtttatggaaactgccgcagtcactgtagccctgacc
atgccgaatgttcttgttgatacttccggactgaaaagccaagtgaagctatttggaatg
aatacggaattcccgctgcaaaagcagattggcacgaagacggctgccgtagggaatgaa
cgggttgaaatgttttataacaaagtaaaagcgccggcagtaaactactatgacttagaa
gtgaataaaaccggccattactttacacatccttcaaacaagtctgaacaaacgaccgca
aaagcagaaaaaacgttaagcacattgcctgaaggaacggtatcagaggtctacctttca
tatgaccgtgcatatccgacaaaagacgtgtataacaaattcaaaggctatgatgtgagc
tttttgtggaacgcaatcgaaacagagaaaaacacaaataagacagcttccacagaacct
cttggctatcctggaaaggattcaaagttcttggccgcccttaatacaaaaggcaagtcg
aatggcgatcagtttatcaacgccctgaaattcatgtccaaacacgaaaaatgggctcag
gtcatttcaaaacggaaagacctgaatgtagataaccgattagattatgtagagaaaaac
ggtgtcaatgtatacggttcggtcgttacagggccaaccaaggaaatccagcgcatgctg
aaaaataaatctgtaaaatcagcgaatgtcggcgaggtggaattatggaactggtaa

DBGET integrated database retrieval system