KEGG   Bacillus subtilis subsp. subtilis 168: BSU09520
Entry
BSU09520          CDS       T00010                                 

Symbol
sigM
Name
(RefSeq) RNA polymerase sigma factor SigM
  KO
K03088  RNA polymerase sigma-70 factor, ECF subfamily
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:bsu03021]
    BSU09520 (sigM)
Transcription machinery [BR:bsu03021]
 Prokaryotic type
  Bacterial type
   RNA polymerase
    Sigma factors
     BSU09520 (sigM)
SSDB
Motif
Pfam: Sigma70_r2 Sigma70_r4_2 Sigma70_r4 DUF134 Sigma70_ECF
Other DBs
NCBI-GeneID: 936267
NCBI-ProteinID: NP_388833
Pasteur: BG13019
BSORF: BG13019
UniProt: O07582 A0A6M3ZE71
Position
complement(1029577..1030068)
AA seq 163 aa
MTIDEIYQMYMNDVYRFLLSMTKDKHLAEDLLQETFMRAYIHIHSYDHSKVKPWLFQVAR
NAFIDYVRKHKKEVTISDDLIGSLFQNAVQSPAHQVEIKEVLTGYMSELPDNYREALTLY
YLKELNYKEASHIMNISEANFKSVLFRARQRLKALYNRGVNDE
NT seq 492 nt   +upstreamnt  +downstreamnt
gtgacgatcgatgaaatttaccaaatgtacatgaatgatgtttacaggttcctgctctcc
atgacaaaagacaagcatcttgctgaagacttactgcaggaaacctttatgcgggcatac
atacacattcactcctatgatcacagcaaagtaaagccctggctttttcaagtggcgcga
aacgccttcattgattacgtcagaaagcataagaaagaagtaaccatttctgatgactta
atcggaagcctctttcaaaatgctgttcaaagtcctgcccatcaggtagagataaaggaa
gtgctgactggttatatgtccgagctccccgataattatcgggaggccttaacgctatat
tatttaaaagagttaaactacaaagaagcatcccatattatgaatatttcagaggcgaat
tttaaaagtgttttatttcgtgccagacagcggctgaaagcactttataatagaggtgtt
aatgatgaatga

DBGET integrated database retrieval system